PDB entry 5zr2

View 5zr2 on RCSB PDB site
Description: Crystal Structure of Phosphoserine Phosphatase Mutant (H9A) from Entamoeba histolytica in complex with Phosphoserine
Class: hydrolase
Keywords: Histidine phosphatase superfamily, phosphoserine phosphatase, cysteine biosynthetic pathway, HYDROLASE
Deposited on 2018-04-23, released 2019-04-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-24, with a file datestamp of 2019-04-19.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycerate mutase family protein, putative
    Species: Entamoeba histolytica HM-1:IMSS-A [TaxId:885318]
    Gene: EHI7A_041450
    Database cross-references and differences (RAF-indexed):
    • Uniprot N9V397 (0-End)
      • engineered mutation (8)
    Domains in SCOPe 2.07: d5zr2a_
  • Chain 'B':
    Compound: Phosphoglycerate mutase family protein, putative
    Species: Entamoeba histolytica HM-1:IMSS-A [TaxId:885318]
    Gene: EHI7A_041450
    Database cross-references and differences (RAF-indexed):
    • Uniprot N9V397 (0-End)
      • engineered mutation (8)
    Domains in SCOPe 2.07: d5zr2b_
  • Chain 'C':
    Compound: Phosphoglycerate mutase family protein, putative
    Species: Entamoeba histolytica HM-1:IMSS-A [TaxId:885318]
    Gene: EHI7A_041450
    Database cross-references and differences (RAF-indexed):
    • Uniprot N9V397 (0-End)
      • engineered mutation (8)
    Domains in SCOPe 2.07: d5zr2c_
  • Chain 'D':
    Compound: Phosphoglycerate mutase family protein, putative
    Species: Entamoeba histolytica HM-1:IMSS-A [TaxId:885318]
    Gene: EHI7A_041450
    Database cross-references and differences (RAF-indexed):
    • Uniprot N9V397 (0-End)
      • engineered mutation (8)
    Domains in SCOPe 2.07: d5zr2d_
  • Heterogens: SEP, SO4, PG4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zr2A (A:)
    mtkliliragetewnllgkiqgctdieltpngiqqanevaqqikgnfdiiyssplhrali
    taqkiagdkevhliegmkeipfgtweghtfeelngdinykkflsgedgcpfdstgmsias
    wskknaqllldlckqnenktivcvshgawiktsilgllemeptmyhkfqlgntgittfif
    rhghpvltsfnstqhlltenksktghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zr2A (A:)
    mtkliliragetewnllgkiqgctdieltpngiqqanevaqqikgnfdiiyssplhrali
    taqkiagdkevhliegmkeipfgtweghtfeelngdinykkflsgedgcpfdstgmsias
    wskknaqllldlckqnenktivcvshgawiktsilgllemeptmyhkfqlgntgittfif
    rhghpvltsfnstqhll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zr2B (B:)
    mtkliliragetewnllgkiqgctdieltpngiqqanevaqqikgnfdiiyssplhrali
    taqkiagdkevhliegmkeipfgtweghtfeelngdinykkflsgedgcpfdstgmsias
    wskknaqllldlckqnenktivcvshgawiktsilgllemeptmyhkfqlgntgittfif
    rhghpvltsfnstqhlltenksktghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zr2B (B:)
    mtkliliragetewnllgkiqgctdieltpngiqqanevaqqikgnfdiiyssplhrali
    taqkiagdkevhliegmkeipfgtweghtfeelngdinykkflsgedgcpfdstgmsias
    wskknaqllldlckqnenktivcvshgawiktsilgllemeptmyhkfqlgntgittfif
    rhghpvltsfnstqhll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zr2C (C:)
    mtkliliragetewnllgkiqgctdieltpngiqqanevaqqikgnfdiiyssplhrali
    taqkiagdkevhliegmkeipfgtweghtfeelngdinykkflsgedgcpfdstgmsias
    wskknaqllldlckqnenktivcvshgawiktsilgllemeptmyhkfqlgntgittfif
    rhghpvltsfnstqhlltenksktghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zr2C (C:)
    mtkliliragetewnllgkiqgctdieltpngiqqanevaqqikgnfdiiyssplhrali
    taqkiagdkevhliegmkeipfgtweghtfeelngdinykkflsgedgcpfdstgmsias
    wskknaqllldlckqnenktivcvshgawiktsilgllemeptmyhkfqlgntgittfif
    rhghpvltsfnstqhllt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zr2D (D:)
    mtkliliragetewnllgkiqgctdieltpngiqqanevaqqikgnfdiiyssplhrali
    taqkiagdkevhliegmkeipfgtweghtfeelngdinykkflsgedgcpfdstgmsias
    wskknaqllldlckqnenktivcvshgawiktsilgllemeptmyhkfqlgntgittfif
    rhghpvltsfnstqhlltenksktghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zr2D (D:)
    mtkliliragetewnllgkiqgctdieltpngiqqanevaqqikgnfdiiyssplhrali
    taqkiagdkevhliegmkeipfgtweghtfeelngdinykkflsgedgcpfdstgmsias
    wskknaqllldlckqnenktivcvshgawiktsilgllemeptmyhkfqlgntgittfif
    rhghpvltsfnstqhll