PDB entry 5zqv

View 5zqv on RCSB PDB site
Description: Crystal Structure of Protein Phosphate 1 complexed with PP1 binding domain of GM
Class: hydrolase
Keywords: Glycogen metabolism, Protein Phosphate 1 holoenzyme, HYDROLASE
Deposited on 2018-04-20, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
    Species: Mus musculus [TaxId:10090]
    Gene: PPP1CA, PPP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqva_
  • Chain 'B':
    Compound: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
    Species: Mus musculus [TaxId:10090]
    Gene: PPP1CA, PPP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqvb_
  • Chain 'C':
    Compound: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
    Species: Mus musculus [TaxId:10090]
    Gene: PPP1CA, PPP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqvc_
  • Chain 'D':
    Compound: Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
    Species: Mus musculus [TaxId:10090]
    Gene: PPP1CA, PPP1A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqvd_
  • Chain 'E':
    Compound: Protein phosphatase 1 regulatory subunit 3A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP1R3A, PP1G
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Protein phosphatase 1 regulatory subunit 3A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP1R3A, PP1G
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Protein phosphatase 1 regulatory subunit 3A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP1R3A, PP1G
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Protein phosphatase 1 regulatory subunit 3A
    Species: Homo sapiens [TaxId:9606]
    Gene: PPP1R3A, PP1G
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FLC, MN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zqvA (A:)
    msdseklnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplk
    icgdihgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykirypenffl
    lrgnhecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdl
    qsmeqirrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhd
    ldlicrahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad
    knkgkygqfsglnpggrpitpprnsakakkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqvA (A:)
    klnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdi
    hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykirypenffllrgnh
    ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
    irrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlic
    rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zqvB (B:)
    msdseklnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplk
    icgdihgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykirypenffl
    lrgnhecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdl
    qsmeqirrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhd
    ldlicrahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad
    knkgkygqfsglnpggrpitpprnsakakkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqvB (B:)
    lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
    gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykirypenffllrgnhe
    casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
    rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
    ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zqvC (C:)
    msdseklnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplk
    icgdihgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykirypenffl
    lrgnhecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdl
    qsmeqirrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhd
    ldlicrahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad
    knkgkygqfsglnpggrpitpprnsakakkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqvC (C:)
    klnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdi
    hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykirypenffllrgnh
    ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
    irrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlic
    rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zqvD (D:)
    msdseklnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplk
    icgdihgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykirypenffl
    lrgnhecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdl
    qsmeqirrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhd
    ldlicrahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad
    knkgkygqfsglnpggrpitpprnsakakkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqvD (D:)
    klnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdi
    hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykirypenffllrgnh
    ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
    irrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlic
    rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.