PDB entry 5zql

View 5zql on RCSB PDB site
Description: crystal structure of human katanin AAA ATPase domain
Class: hydrolase
Keywords: Katanin p60, AAA ATPase, HYDROLASE
Deposited on 2018-04-19, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Katanin p60 ATPase-containing subunit A1
    Species: Homo sapiens [TaxId:9606]
    Gene: Katna1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75449
      • engineered mutation (126)
    Domains in SCOPe 2.07: d5zqla_
  • Chain 'B':
    Compound: Katanin p60 ATPase-containing subunit A1
    Species: Homo sapiens [TaxId:9606]
    Gene: Katna1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75449 (Start-308)
      • engineered mutation (126)
    Domains in SCOPe 2.07: d5zqlb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zqlA (A:)
    dstgydkdlvealerdiisqnpnvrwddiadlveakkllkeavvlpmwmpeffkgirrpw
    kgvlmvgppgtgktllakavateckttffnvssstltskyrgeseklvrllfemarfysp
    atifidqidsicsrrgtseeheasrrvkaellvqmdgvggtsenddpskmvmvlaatnfp
    wdidealrrrlekriyiplpsakgreellrislreleladdvdlasiaenmegysgadit
    nvcrdaslmamrrriegltpeeirnlskeemhmpttmedfemalkkvsksvsaadierye
    kwifefgsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqlA (A:)
    vealerdiisqnpnvrwddiadlveakkllkeavvlpmwmpeffkgirrpwkgvlmvgpp
    gtgktllakavateckttffnvssstltskyrgeseklvrllfemarfyspatifidqid
    sicseasrrvkaellvqmmvmvlaatnfpwdidealrrrlekriyiplpsakgreellri
    slrdlasiaenmegysgaditnvcrdaslmamrrrieglttmedfemalkkvsksvsaad
    ieryekwifefg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zqlB (B:)
    dstgydkdlvealerdiisqnpnvrwddiadlveakkllkeavvlpmwmpeffkgirrpw
    kgvlmvgppgtgktllakavateckttffnvssstltskyrgeseklvrllfemarfysp
    atifidqidsicsrrgtseeheasrrvkaellvqmdgvggtsenddpskmvmvlaatnfp
    wdidealrrrlekriyiplpsakgreellrislreleladdvdlasiaenmegysgadit
    nvcrdaslmamrrriegltpeeirnlskeemhmpttmedfemalkkvsksvsaadierye
    kwifefgsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqlB (B:)
    vealerdiisqnpnvrwddiadlveakkllkeavvlpmwmpeffkgirrpwkgvlmvgpp
    gtgktllakavateckttffnvssstltskyrgeseklvrllfemarfyspatifidqid
    sicseheasrrvkaellvqmmvmvlaatnfpwdidealrrrlekriyiplpsakgreell
    rislrdlasiaenmegysgaditnvcrdaslmamrrriegltpetmedfemalkkvsksv
    saadieryekwifefgsc