PDB entry 5zqj

View 5zqj on RCSB PDB site
Description: Crystal structure of beta-xylosidase from Bacillus pumilus
Class: hydrolase
Keywords: xylobiose hydrolysis, HYDROLASE
Deposited on 2018-04-19, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-xylosidase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: xynB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqja1, d5zqja2
  • Chain 'B':
    Compound: beta-xylosidase
    Species: Bacillus pumilus [TaxId:1408]
    Gene: xynB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqjb1, d5zqjb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zqjA (A:)
    mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq
    ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr
    lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt
    piklteaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps
    hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw
    pyvvggkeglleveapamsvkefsptyhivdefkdsslnrhfqtlripftdqigsvtenp
    hhlrlygqesltskftqafvarrwqsfyfeaetavsffpknfqqaaglvnyyntenwtal
    qvtyddalgrilelsvcenlafsqplikkiiipdeipyvylkvtvqretytysysfdqqe
    wekidvplesthlsddfirgggfftgafvgmqcqdtsgerlpadfkyfryeettehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqjA (A:)
    mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq
    ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr
    lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt
    piklteaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps
    hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw
    pyvvggkeglleveapamsvkefsptyhivdefkdsslnrhfqtlripftdqigsvtenp
    hhlrlygqesltskftqafvarrwqsfyfeaetavsffpknfqqaaglvnyyntenwtal
    qvtyddalgrilelsvcenlafsqplikkiiipdeipyvylkvtvqretytysysfdqqe
    wekidvplesthlsddfirgggfftgafvgmqcqdtsgerlpadfkyfryeette
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zqjB (B:)
    mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq
    ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr
    lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt
    piklteaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps
    hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw
    pyvvggkeglleveapamsvkefsptyhivdefkdsslnrhfqtlripftdqigsvtenp
    hhlrlygqesltskftqafvarrwqsfyfeaetavsffpknfqqaaglvnyyntenwtal
    qvtyddalgrilelsvcenlafsqplikkiiipdeipyvylkvtvqretytysysfdqqe
    wekidvplesthlsddfirgggfftgafvgmqcqdtsgerlpadfkyfryeettehhhhh
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqjB (B:)
    mkitnpvlkgfnpdpsicragedyymavstfewfpgvqiyhskdlihwrlaarplqktsq
    ldmkgnpdsggvwapclsyadgqfwliysdikvvdgpfkdghnylvtadavdgewsdpvr
    lnssgfdpslfhdpsgkkyvlnmlwdhrekhhsfagialqeysvsekklvgerkvifkgt
    piklteaphlyyindvyylltaeggtryehaatiarssridgpyevhpdnpiltafhaps
    hplqkcghasivqthtnewylahltgrpihsskesifqqrgwcplgretaiqklewkdgw
    pyvvggkeglleveapamsvkefsptyhivdefkdsslnrhfqtlripftdqigsvtenp
    hhlrlygqesltskftqafvarrwqsfyfeaetavsffpknfqqaaglvnyyntenwtal
    qvtyddalgrilelsvcenlafsqplikkiiipdeipyvylkvtvqretytysysfdqqe
    wekidvplesthlsddfirgggfftgafvgmqcqdtsgerlpadfkyfryeet