PDB entry 5zqh

View 5zqh on RCSB PDB site
Description: Crystal structure of Streptococcus transcriptional regulator
Class: DNA binding protein
Keywords: Bacteria, PadR, antibiotic resistance, regulator, transcription, DNA BINDING PROTEIN
Deposited on 2018-04-19, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PadR family transcriptional regulator
    Species: Streptococcus pneumoniae [TaxId:1313]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zqhA (A:)
    etqllkgvlegcvldmigqkerygyelvqtlreagfdtivpgtiypllqkleknqwirgd
    mrpspdgpdrkyfslmkegeervsvfwqqwddlsqkvegikn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqhA (A:)
    etqllkgvlegcvldmigqkerygyelvqtlreagfdtivgtiypllqkleknqwirgdm
    rpspdgpdrkyfslmkegeervsvfwqqwddlsqkvegikn