PDB entry 5zqe

View 5zqe on RCSB PDB site
Description: Crystal Structure of Penicillin-Binding Protein D2 from Listeria monocytogenes in the Cefuroxime bound form
Class: antibiotic
Keywords: penicillin-binding protein D2, Listeria monocytogenes, antibiotics, beta-lactams, DD-carboxypeptidase, lmo2812, LmPBPD2, ANTIBIOTIC
Deposited on 2018-04-18, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lmo2812 protein
    Species: Listeria monocytogenes EGD-e [TaxId:169963]
    Gene: lmo2812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqea_
  • Chain 'B':
    Compound: Lmo2812 protein
    Species: Listeria monocytogenes EGD-e [TaxId:169963]
    Gene: lmo2812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqeb_
  • Chain 'C':
    Compound: Lmo2812 protein
    Species: Listeria monocytogenes EGD-e [TaxId:169963]
    Gene: lmo2812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqec_
  • Chain 'D':
    Compound: Lmo2812 protein
    Species: Listeria monocytogenes EGD-e [TaxId:169963]
    Gene: lmo2812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqed_
  • Chain 'E':
    Compound: Lmo2812 protein
    Species: Listeria monocytogenes EGD-e [TaxId:169963]
    Gene: lmo2812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqee_
  • Chain 'F':
    Compound: Lmo2812 protein
    Species: Listeria monocytogenes EGD-e [TaxId:169963]
    Gene: lmo2812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqef_
  • Chain 'G':
    Compound: Lmo2812 protein
    Species: Listeria monocytogenes EGD-e [TaxId:169963]
    Gene: lmo2812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqeg_
  • Chain 'H':
    Compound: Lmo2812 protein
    Species: Listeria monocytogenes EGD-e [TaxId:169963]
    Gene: lmo2812
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zqeh_
  • Heterogens: CES, GOL, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zqeA (A:)
    hhhhhhdydipttenlyfqgamgssteqpnlylsanaaavysvengealyeqnadkvmpi
    aslsklmtaflvleavdnnelswdekldlvrlddpsavslyaitqkrtwsvrdlysamlt
    msandaaetlgdrldgadfpkemnnqakklgmsskttfvsasgldvdgksavsttkdlfl
    lssklisthpevlettskptvttdkgaklestndllgsiqgldglktgftdeagycfigt
    aerggkrvisivldagtaekrfkdteklmevgfked
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqeA (A:)
    qpnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekl
    dlvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqa
    kklgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkga
    klestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtek
    lmevgfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zqeB (B:)
    hhhhhhdydipttenlyfqgamgssteqpnlylsanaaavysvengealyeqnadkvmpi
    aslsklmtaflvleavdnnelswdekldlvrlddpsavslyaitqkrtwsvrdlysamlt
    msandaaetlgdrldgadfpkemnnqakklgmsskttfvsasgldvdgksavsttkdlfl
    lssklisthpevlettskptvttdkgaklestndllgsiqgldglktgftdeagycfigt
    aerggkrvisivldagtaekrfkdteklmevgfked
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqeB (B:)
    qpnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekl
    dlvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqa
    kklgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkga
    klestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtek
    lmevgfk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zqeC (C:)
    hhhhhhdydipttenlyfqgamgssteqpnlylsanaaavysvengealyeqnadkvmpi
    aslsklmtaflvleavdnnelswdekldlvrlddpsavslyaitqkrtwsvrdlysamlt
    msandaaetlgdrldgadfpkemnnqakklgmsskttfvsasgldvdgksavsttkdlfl
    lssklisthpevlettskptvttdkgaklestndllgsiqgldglktgftdeagycfigt
    aerggkrvisivldagtaekrfkdteklmevgfked
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqeC (C:)
    pnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekld
    lvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqak
    klgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkgak
    lestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtekl
    mevgfk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zqeD (D:)
    hhhhhhdydipttenlyfqgamgssteqpnlylsanaaavysvengealyeqnadkvmpi
    aslsklmtaflvleavdnnelswdekldlvrlddpsavslyaitqkrtwsvrdlysamlt
    msandaaetlgdrldgadfpkemnnqakklgmsskttfvsasgldvdgksavsttkdlfl
    lssklisthpevlettskptvttdkgaklestndllgsiqgldglktgftdeagycfigt
    aerggkrvisivldagtaekrfkdteklmevgfked
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqeD (D:)
    pnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekld
    lvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqak
    klgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkgak
    lestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtekl
    mevgfk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5zqeE (E:)
    hhhhhhdydipttenlyfqgamgssteqpnlylsanaaavysvengealyeqnadkvmpi
    aslsklmtaflvleavdnnelswdekldlvrlddpsavslyaitqkrtwsvrdlysamlt
    msandaaetlgdrldgadfpkemnnqakklgmsskttfvsasgldvdgksavsttkdlfl
    lssklisthpevlettskptvttdkgaklestndllgsiqgldglktgftdeagycfigt
    aerggkrvisivldagtaekrfkdteklmevgfked
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqeE (E:)
    qpnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekl
    dlvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqa
    kklgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkga
    klestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtek
    lmevgfk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5zqeF (F:)
    hhhhhhdydipttenlyfqgamgssteqpnlylsanaaavysvengealyeqnadkvmpi
    aslsklmtaflvleavdnnelswdekldlvrlddpsavslyaitqkrtwsvrdlysamlt
    msandaaetlgdrldgadfpkemnnqakklgmsskttfvsasgldvdgksavsttkdlfl
    lssklisthpevlettskptvttdkgaklestndllgsiqgldglktgftdeagycfigt
    aerggkrvisivldagtaekrfkdteklmevgfked
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqeF (F:)
    qpnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekl
    dlvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqa
    kklgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkga
    klestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtek
    lmevgfk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5zqeG (G:)
    hhhhhhdydipttenlyfqgamgssteqpnlylsanaaavysvengealyeqnadkvmpi
    aslsklmtaflvleavdnnelswdekldlvrlddpsavslyaitqkrtwsvrdlysamlt
    msandaaetlgdrldgadfpkemnnqakklgmsskttfvsasgldvdgksavsttkdlfl
    lssklisthpevlettskptvttdkgaklestndllgsiqgldglktgftdeagycfigt
    aerggkrvisivldagtaekrfkdteklmevgfked
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqeG (G:)
    qpnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekl
    dlvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqa
    kklgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkga
    klestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtek
    lmevgfk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5zqeH (H:)
    hhhhhhdydipttenlyfqgamgssteqpnlylsanaaavysvengealyeqnadkvmpi
    aslsklmtaflvleavdnnelswdekldlvrlddpsavslyaitqkrtwsvrdlysamlt
    msandaaetlgdrldgadfpkemnnqakklgmsskttfvsasgldvdgksavsttkdlfl
    lssklisthpevlettskptvttdkgaklestndllgsiqgldglktgftdeagycfigt
    aerggkrvisivldagtaekrfkdteklmevgfked
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zqeH (H:)
    qpnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekl
    dlvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqa
    kklgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkga
    klestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtek
    lmevgfk