PDB entry 5zq5

View 5zq5 on RCSB PDB site
Description: SidE-Ubi
Class: cell invasion
Keywords: ubiquitination, CELL INVASION
Deposited on 2018-04-17, released 2018-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.4899999999999998 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SidE
    Species: Legionella pneumophila [TaxId:446]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6RCR1 (1-836)
      • expression tag (837)
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (3-78)
      • engineered mutation (44)
    Domains in SCOPe 2.08: d5zq5b_
  • Chain 'C':
    Compound: SidE
    Species: Legionella pneumophila [TaxId:446]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6RCR1 (Start-836)
      • expression tag (837)
  • Chain 'D':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Gene: UBC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CG48 (3-78)
      • engineered mutation (44)
    Domains in SCOPe 2.08: d5zq5d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zq5B (B:)
    ggsmqifvktltgktitlevepsdtienvkakiqdkegippdqqalifagkqledgrtls
    dyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zq5B (B:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqalifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zq5D (D:)
    ggsmqifvktltgktitlevepsdtienvkakiqdkegippdqqalifagkqledgrtls
    dyniqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zq5D (D:)
    mqifvktltgktitlevepsdtienvkakiqdkegippdqqalifagkqledgrtlsdyn
    iqkestlhlvlrlrgg