PDB entry 5zpv

View 5zpv on RCSB PDB site
Description: Solution Structure of Thioredoxin-Like Effector Protein (TRX3) from Edwardsiella piscicida
Class: oxidoreductase
Keywords: Inhibitor, Redox activity, reactivity, active site, thiol-disulfide oxidoreductase, OXIDOREDUCTASE
Deposited on 2018-04-16, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin (H-type,TRX-H)
    Species: Edwardsiella tarda EIB202 [TaxId:498217]
    Gene: ETAE_2186
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zpva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zpvA (A:)
    mhhhhhhssglvprgsqaasvepysdaaftqaqasgapvlvdvyadwcpvckrqereltp
    lfaqpaqrdlrvfkvnfdtqkaalqqfrvsqqstlilyrngqevrrsigetspsalsdfl
    tr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zpvA (A:)
    qaasvepysdaaftqaqasgapvlvdvyadwcpvckrqereltplfaqpaqrdlrvfkvn
    fdtqkaalqqfrvsqqstlilyrngqevrrsigetspsalsdfltr