PDB entry 5zor

View 5zor on RCSB PDB site
Description: Solution structure of centrin4 from Trypanosoma brucei
Class: metal binding protein
Keywords: centrin, EF-hand, calcium binding, Trypanosoma brucei, METAL BINDING PROTEIN
Deposited on 2018-04-15, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Centrin, putative
    Species: Trypanosoma brucei brucei (strain 927/4 GUTat10.1) [TaxId:185431]
    Gene: Tb927.7.3410
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zora_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zorA (A:)
    maaltdeqireafnlfdadgsgaidaeemalamkglgfgdlprdevertvrsmntnangl
    ieygefermvksrmaqkdspeevlkafqlfdldkkgkisfanlkevakllgenpgddvlq
    emiaeadedgdgevsfeefksvmmqmrgk