PDB entry 5zol

View 5zol on RCSB PDB site
Description: Crystal structure of a three sites mutantion of FSAA complexed with HA and product
Class: lyase
Keywords: Fructose-6-phosphate aldolase, donor, acceptor, mutant, flexible, LYASE
Deposited on 2018-04-13, released 2019-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-12, with a file datestamp of 2019-06-07.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fsaA, fsa, mipB, ybiZ, b0825, JW5109
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (35-254)
      • expression tag (33-34)
      • engineered mutation (65)
      • engineered mutation (93)
      • engineered mutation (229)
    Domains in SCOPe 2.07: d5zola1, d5zola2
  • Chain 'B':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fsaA, fsa, mipB, ybiZ, b0825, JW5109
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (35-254)
      • expression tag (34)
      • engineered mutation (65)
      • engineered mutation (93)
      • engineered mutation (229)
    Domains in SCOPe 2.07: d5zolb1, d5zolb2
  • Chain 'C':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fsaA, fsa, mipB, ybiZ, b0825, JW5109
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (35-254)
      • expression tag (34)
      • engineered mutation (65)
      • engineered mutation (93)
      • engineered mutation (229)
    Domains in SCOPe 2.07: d5zolc1, d5zolc2
  • Chain 'D':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fsaA, fsa, mipB, ybiZ, b0825, JW5109
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (35-254)
      • expression tag (34)
      • engineered mutation (65)
      • engineered mutation (93)
      • engineered mutation (229)
    Domains in SCOPe 2.07: d5zold1, d5zold2
  • Chain 'E':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fsaA, fsa, mipB, ybiZ, b0825, JW5109
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (35-254)
      • expression tag (34)
      • engineered mutation (65)
      • engineered mutation (93)
      • engineered mutation (229)
    Domains in SCOPe 2.07: d5zole1, d5zole2
  • Chain 'F':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fsaA, fsa, mipB, ybiZ, b0825, JW5109
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (35-254)
      • expression tag (34)
      • engineered mutation (65)
      • engineered mutation (93)
      • engineered mutation (229)
    Domains in SCOPe 2.07: d5zolf1, d5zolf2
  • Chain 'G':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fsaA, fsa, mipB, ybiZ, b0825, JW5109
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (35-254)
      • expression tag (33-34)
      • engineered mutation (65)
      • engineered mutation (93)
      • engineered mutation (229)
    Domains in SCOPe 2.07: d5zolg1, d5zolg2
  • Chain 'H':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fsaA, fsa, mipB, ybiZ, b0825, JW5109
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (35-254)
      • expression tag (34)
      • engineered mutation (65)
      • engineered mutation (93)
      • engineered mutation (229)
    Domains in SCOPe 2.07: d5zolh1, d5zolh2
  • Chain 'I':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fsaA, fsa, mipB, ybiZ, b0825, JW5109
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (35-254)
      • expression tag (34)
      • engineered mutation (65)
      • engineered mutation (93)
      • engineered mutation (229)
    Domains in SCOPe 2.07: d5zoli1, d5zoli2
  • Chain 'J':
    Compound: Fructose-6-phosphate aldolase 1
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fsaA, fsa, mipB, ybiZ, b0825, JW5109
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78055 (35-254)
      • expression tag (34)
      • engineered mutation (65)
      • engineered mutation (93)
      • engineered mutation (229)
    Domains in SCOPe 2.07: d5zolj1, d5zolj2
  • Heterogens: 4Y8, LW2, CL, SO4, LW1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zolA (A:)
    hhhhhhssglvprgsgmketaaakferqhmdsprsmelyldtsdvvavkalsrifplagv
    ttnpstiaagkkpldvvlpqlheamggqgrlfatvmattaegmvndalklrsiiadivvk
    vpvtaeglaaikmlkaegiptlgtavygaaqgllsalagaeyvapyvnridaqggsgiqt
    vtdlhqllkmhapqakvlaasfktprqaldcllagcesitlpldvaqqmqsypavdaava
    kfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zolA (A:)
    rsmelyldtsdvvavkalsrifplagvttnpstiaagkkpldvvlpqlheamggqgrlfa
    tvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgl
    lsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcll
    agcesitlpldvaqqmqsypavdaavakfeqdwqgafgrtsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zolB (B:)
    hhhhhhssglvprgsgmketaaakferqhmdsprsmelyldtsdvvavkalsrifplagv
    ttnpstiaagkkpldvvlpqlheamggqgrlfatvmattaegmvndalklrsiiadivvk
    vpvtaeglaaikmlkaegiptlgtavygaaqgllsalagaeyvapyvnridaqggsgiqt
    vtdlhqllkmhapqakvlaasfktprqaldcllagcesitlpldvaqqmqsypavdaava
    kfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zolB (B:)
    smelyldtsdvvavkalsrifplagvttnpstiaagkkpldvvlpqlheamggqgrlfat
    vmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgll
    salagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldclla
    gcesitlpldvaqqmqsypavdaavakfeqdwqgafgrtsi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zolC (C:)
    hhhhhhssglvprgsgmketaaakferqhmdsprsmelyldtsdvvavkalsrifplagv
    ttnpstiaagkkpldvvlpqlheamggqgrlfatvmattaegmvndalklrsiiadivvk
    vpvtaeglaaikmlkaegiptlgtavygaaqgllsalagaeyvapyvnridaqggsgiqt
    vtdlhqllkmhapqakvlaasfktprqaldcllagcesitlpldvaqqmqsypavdaava
    kfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zolC (C:)
    smelyldtsdvvavkalsrifplagvttnpstiaagkkpldvvlpqlheamggqgrlfat
    vmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgll
    salagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldclla
    gcesitlpldvaqqmqsypavdaavakfeqdwqgafgrtsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zolD (D:)
    hhhhhhssglvprgsgmketaaakferqhmdsprsmelyldtsdvvavkalsrifplagv
    ttnpstiaagkkpldvvlpqlheamggqgrlfatvmattaegmvndalklrsiiadivvk
    vpvtaeglaaikmlkaegiptlgtavygaaqgllsalagaeyvapyvnridaqggsgiqt
    vtdlhqllkmhapqakvlaasfktprqaldcllagcesitlpldvaqqmqsypavdaava
    kfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zolD (D:)
    smelyldtsdvvavkalsrifplagvttnpstiaagkkpldvvlpqlheamggqgrlfat
    vmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgll
    salagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldclla
    gcesitlpldvaqqmqsypavdaavakfeqdwqgafgrtsi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5zolE (E:)
    hhhhhhssglvprgsgmketaaakferqhmdsprsmelyldtsdvvavkalsrifplagv
    ttnpstiaagkkpldvvlpqlheamggqgrlfatvmattaegmvndalklrsiiadivvk
    vpvtaeglaaikmlkaegiptlgtavygaaqgllsalagaeyvapyvnridaqggsgiqt
    vtdlhqllkmhapqakvlaasfktprqaldcllagcesitlpldvaqqmqsypavdaava
    kfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zolE (E:)
    smelyldtsdvvavkalsrifplagvttnpstiaagkkpldvvlpqlheamggqgrlfat
    vmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgll
    salagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldclla
    gcesitlpldvaqqmqsypavdaavakfeqdwqgafgrtsi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5zolF (F:)
    hhhhhhssglvprgsgmketaaakferqhmdsprsmelyldtsdvvavkalsrifplagv
    ttnpstiaagkkpldvvlpqlheamggqgrlfatvmattaegmvndalklrsiiadivvk
    vpvtaeglaaikmlkaegiptlgtavygaaqgllsalagaeyvapyvnridaqggsgiqt
    vtdlhqllkmhapqakvlaasfktprqaldcllagcesitlpldvaqqmqsypavdaava
    kfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zolF (F:)
    smelyldtsdvvavkalsrifplagvttnpstiaagkkpldvvlpqlheamggqgrlfat
    vmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgll
    salagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldclla
    gcesitlpldvaqqmqsypavdaavakfeqdwqgafgrtsi
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5zolG (G:)
    hhhhhhssglvprgsgmketaaakferqhmdsprsmelyldtsdvvavkalsrifplagv
    ttnpstiaagkkpldvvlpqlheamggqgrlfatvmattaegmvndalklrsiiadivvk
    vpvtaeglaaikmlkaegiptlgtavygaaqgllsalagaeyvapyvnridaqggsgiqt
    vtdlhqllkmhapqakvlaasfktprqaldcllagcesitlpldvaqqmqsypavdaava
    kfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zolG (G:)
    rsmelyldtsdvvavkalsrifplagvttnpstiaagkkpldvvlpqlheamggqgrlfa
    tvmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgl
    lsalagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldcll
    agcesitlpldvaqqmqsypavdaavakfeqdwqgafgrtsi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5zolH (H:)
    hhhhhhssglvprgsgmketaaakferqhmdsprsmelyldtsdvvavkalsrifplagv
    ttnpstiaagkkpldvvlpqlheamggqgrlfatvmattaegmvndalklrsiiadivvk
    vpvtaeglaaikmlkaegiptlgtavygaaqgllsalagaeyvapyvnridaqggsgiqt
    vtdlhqllkmhapqakvlaasfktprqaldcllagcesitlpldvaqqmqsypavdaava
    kfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zolH (H:)
    smelyldtsdvvavkalsrifplagvttnpstiaagkkpldvvlpqlheamggqgrlfat
    vmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgll
    salagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldclla
    gcesitlpldvaqqmqsypavdaavakfeqdwqgafgrtsi
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5zolI (I:)
    hhhhhhssglvprgsgmketaaakferqhmdsprsmelyldtsdvvavkalsrifplagv
    ttnpstiaagkkpldvvlpqlheamggqgrlfatvmattaegmvndalklrsiiadivvk
    vpvtaeglaaikmlkaegiptlgtavygaaqgllsalagaeyvapyvnridaqggsgiqt
    vtdlhqllkmhapqakvlaasfktprqaldcllagcesitlpldvaqqmqsypavdaava
    kfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zolI (I:)
    smelyldtsdvvavkalsrifplagvttnpstiaagkkpldvvlpqlheamggqgrlfat
    vmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgll
    salagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldclla
    gcesitlpldvaqqmqsypavdaavakfeqdwqgafgrtsi
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5zolJ (J:)
    hhhhhhssglvprgsgmketaaakferqhmdsprsmelyldtsdvvavkalsrifplagv
    ttnpstiaagkkpldvvlpqlheamggqgrlfatvmattaegmvndalklrsiiadivvk
    vpvtaeglaaikmlkaegiptlgtavygaaqgllsalagaeyvapyvnridaqggsgiqt
    vtdlhqllkmhapqakvlaasfktprqaldcllagcesitlpldvaqqmqsypavdaava
    kfeqdwqgafgrtsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zolJ (J:)
    smelyldtsdvvavkalsrifplagvttnpstiaagkkpldvvlpqlheamggqgrlfat
    vmattaegmvndalklrsiiadivvkvpvtaeglaaikmlkaegiptlgtavygaaqgll
    salagaeyvapyvnridaqggsgiqtvtdlhqllkmhapqakvlaasfktprqaldclla
    gcesitlpldvaqqmqsypavdaavakfeqdwqgafgrtsi