PDB entry 5zok

View 5zok on RCSB PDB site
Description: Crystal structure of human SMAD1-MAN1 complex.
Class: DNA binding protein
Keywords: Transcription, Complex, TGF-beta signaling, DNA BINDING PROTEIN
Deposited on 2018-04-13, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mothers against decapentaplegic homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Smad1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15797 (Start-205)
      • expression tag (206-208)
    Domains in SCOPe 2.07: d5zoka1, d5zoka2
  • Chain 'B':
    Compound: inner nuclear membrane protein man1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAN1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Mothers against decapentaplegic homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Smad1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15797 (Start-205)
      • expression tag (206-208)
    Domains in SCOPe 2.07: d5zokc1, d5zokc2
  • Chain 'D':
    Compound: inner nuclear membrane protein man1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAN1
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zokA (A:)
    gpdvqavayeepkhwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsn
    vnrnstientrrhigkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckips
    gcslkifnnqefaqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwi
    eihlhgplqwldkvltqmgsphnpiseve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zokA (A:)
    eepkhwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstien
    trrhigkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnn
    qefaqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplq
    wldkvltqmgsphnpiseve
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zokC (C:)
    gpdvqavayeepkhwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsn
    vnrnstientrrhigkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckips
    gcslkifnnqefaqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwi
    eihlhgplqwldkvltqmgsphnpiseve
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zokC (C:)
    eepkhwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstien
    trrhigkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnn
    qefaqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplq
    wldkvltqmgsphnpiseve
    

  • Chain 'D':
    No sequence available.