PDB entry 5zoi

View 5zoi on RCSB PDB site
Description: Crystal Structure of alpha1,3-Fucosyltransferase
Class: transferase
Keywords: enzyme, TRANSFERASE
Deposited on 2018-04-13, released 2019-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 3.19 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha-(1,3)-fucosyltransferase FucT
    Species: Helicobacter pylori [TaxId:210]
    Gene: fucT
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30511 (0-End)
      • engineered mutation (44)
      • engineered mutation (126-127)
      • engineered mutation (130)
      • engineered mutation (198)
      • engineered mutation (339)
    Domains in SCOPe 2.07: d5zoia_
  • Chain 'B':
    Compound: Alpha-(1,3)-fucosyltransferase FucT
    Species: Helicobacter pylori [TaxId:210]
    Gene: fucT
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30511 (0-End)
      • engineered mutation (44)
      • engineered mutation (126-127)
      • engineered mutation (130)
      • engineered mutation (198)
      • engineered mutation (339)
    Domains in SCOPe 2.07: d5zoib_
  • Heterogens: C06

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zoiA (A:)
    mfqplldayvesasiekmasksppplkiavanwwgdeeikefknfvlyfilsqrytitlh
    qnpnefsdlvfgnplgsarkilsyqnakrvfytgenespnfnlfdyaigfdeldfndryl
    rmplyynelhikaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkr
    gfasfvasnpnapirnafndalnsiepvtgggsvrntlgynvknkneflsqykfnlcfen
    tqgygyvtekiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhth
    knayldmlyenplntldgkayfyqnlsfkkilaffktildndtiyhdnpfifcrdlnepl
    vtiddlranyddlrvnyddlrinyddlrvnyddlrinyddlrvnyddlrvnylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zoiA (A:)
    mfqplldayvesasiekmasksppplkiavanwwgdeeikefknfvlyfilsqrytitlh
    qnpnefsdlvfgnpyqnakrvfytgenespnfnlfdyaigfdeldfndrylrmplyynel
    hikaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkrgfasfvasn
    pnapirnafndalnsiepvtgggsvrntlgynvknkneflsqykfnlcfentqgygyvte
    kiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhthknayldmly
    enplntldgkayfyqnlsfkkilaffktildndtiyhdnpfif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zoiB (B:)
    mfqplldayvesasiekmasksppplkiavanwwgdeeikefknfvlyfilsqrytitlh
    qnpnefsdlvfgnplgsarkilsyqnakrvfytgenespnfnlfdyaigfdeldfndryl
    rmplyynelhikaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkr
    gfasfvasnpnapirnafndalnsiepvtgggsvrntlgynvknkneflsqykfnlcfen
    tqgygyvtekiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhth
    knayldmlyenplntldgkayfyqnlsfkkilaffktildndtiyhdnpfifcrdlnepl
    vtiddlranyddlrvnyddlrinyddlrvnyddlrinyddlrvnyddlrvnylehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zoiB (B:)
    mfqplldayvesasiekmasksppplkiavanwwgdeeikefknfvlyfilsqrytitlh
    qnpnefsdlvfgnpyqnakrvfytgenespnfnlfdyaigfdeldfndrylrmplyynel
    hikaesvndttapyklkdnslyalkkpshcfkekhpnlcavvndesdplkrgfasfvasn
    pnapirnafndalnsiepvtgggsvrntlgynvknkneflsqykfnlcfentqgygyvte
    kiidayfshtipiywgspsvakdfnpksfvnvhdfknfdeaidyikylhthknayldmly
    enplntldgkayfyqnlsfkkilaffktildndtiyhdnpfif