PDB entry 5zoc

View 5zoc on RCSB PDB site
Description: Crystal structure of APRT from Y. pseudotuberculosis with bound adenine (C2 space group).
Class: transferase
Keywords: adenine phosphoribosyltransferase, Yersinia pseudotuberculosis, adenine, TRANSFERASE
Deposited on 2018-04-12, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenine phosphoribosyltransferase
    Species: Yersinia pseudotuberculosis IP 32953 [TaxId:273123]
    Gene: apt, YPTB0991
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zoca_
  • Heterogens: ADE, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zocA (A:)
    mtvsasktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesg
    vtkvvgteargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsi
    qpgdkvlvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcys
    lvsfdgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zocA (A:)
    qlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesgvtkvvgtear
    gflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsiqpgdkvlvvd
    dllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcyslvsfdgh