PDB entry 5zoa

View 5zoa on RCSB PDB site
Description: The crystal structure of a Thermobifida fusca cutinase
Class: hydrolase
Keywords: cutin, Thermobifida fusca cutinase hydrolysis activity, HYDROLASE
Deposited on 2018-04-12, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BTA-hydrolase 1
    Species: Thermobifida fusca [TaxId:2021]
    Gene: bta1, cut_2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zoaa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zoaA (A:)
    anpyergpnptdalleassgpfsvseenvsrlsasgfgggtiyyprenntygavaispgy
    tgteasiawlgeriashgfvvitidtittldqpdsraeqlnaalnhminrasstvrsrid
    ssrlavmghsmggggtlrlasqrpdlkaaipltpwhlnknwssvtvptliigadldtiap
    vathakpfynslpssiskayleldgathfapnipnkiigkysvawlkrfvdndtrytqfl
    cpgprdglfgeveeyrstcpf