PDB entry 5zo6

View 5zo6 on RCSB PDB site
Description: Crystal structure of C166, a backbone circularized G-CSF
Class: cytokine
Keywords: cytokine, four-helix bundle, back-bone circularization
Deposited on 2018-04-12, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: granulocyte colony-stimulating factor
    Species: Homo sapiens [TaxId:9606]
    Gene: CSF3, C17orf33, GCSF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09919 (0-165)
      • engineered mutation (10)
      • engineered mutation (165)
    Domains in SCOPe 2.07: d5zo6x_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zo6X (X:)
    sslpqsfllksleqvrkiqgdgaalqeklcatyklchpeelvllghslgipwaplsscps
    qalqlagclsqlhsglflyqgllqalegispelgptldtlqldvadfattiwqqmeelgm
    apalqptqgampafasafqrraggvlvashlqsflevsyrvlrhlg