PDB entry 5zo0

View 5zo0 on RCSB PDB site
Description: Neutron structure of xylanase at pD5.4
Class: hydrolase
Keywords: family 11 GH, neutron crystallography, protonation state, HYDROLASE
Deposited on 2018-04-12, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: NEUT
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-1,4-beta-xylanase 2
    Species: Hypocrea jecorina (strain ATCC 56765 / BCRC 32924 / NRRL 11460 / Rut C-30) [TaxId:1344414]
    Gene: xyn2, M419DRAFT_124931
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zo0a_
  • Heterogens: DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zo0A (A:)
    tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgnfvggkgwqpgtknkvin
    fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
    rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
    sgsasitvs