PDB entry 5znx

View 5znx on RCSB PDB site
Description: Crystal structure of CM14-treated HlyU from Vibrio vulnificus
Class: DNA binding protein
Keywords: transcription activator, DNA BINDING PROTEIN
Deposited on 2018-04-11, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional activator
    Species: Vibrio vulnificus CMCP6 [TaxId:216895]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZNX (Start-101)
    Domains in SCOPe 2.07: d5znxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5znxA (A:)
    gamgsnlkdmeqnsakavvllkamanerrlqilcmlhnqelsvgelcaklqlsqsalsqh
    lawlrrdglvttrkeaqtvyytlkseevkamikllhslycee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5znxA (A:)
    kdmeqnsakavvllkamanerrlqilcmlhnqelsvgelcaklqlsqsalsqhlawlrrd
    glvttrkeaqtvyytlkseevkamikllhslycee