PDB entry 5zno

View 5zno on RCSB PDB site
Description: Crystal structure of PET-degrading cutinase Cut190 S176A/S226P/R228S/ mutant in Ca(2+)-bound state
Class: hydrolase
Keywords: polyesterase, alpha/beta-hydrolase fold, protein engineering, thermostability, hydrolase
Deposited on 2018-04-10, released 2018-09-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-09-26, with a file datestamp of 2018-09-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha/beta hydrolase family protein
    Species: Saccharomonospora viridis [TaxId:1852]
    Gene: Cut190, SAMN02982918_2340
    Database cross-references and differences (RAF-indexed):
    • Uniprot W0TJ64 (Start-261)
      • engineered mutation (133)
      • engineered mutation (183)
      • engineered mutation (185)
      • expression tag (262)
    Domains in SCOPe 2.08: d5znoa1, d5znoa2
  • Chain 'B':
    Compound: Alpha/beta hydrolase family protein
    Species: Saccharomonospora viridis [TaxId:1852]
    Gene: Cut190, SAMN02982918_2340
    Database cross-references and differences (RAF-indexed):
    • Uniprot W0TJ64 (Start-261)
      • engineered mutation (133)
      • engineered mutation (183)
      • engineered mutation (185)
      • expression tag (262-263)
    Domains in SCOPe 2.08: d5znob1, d5znob2
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5znoA (A:)
    gpqdnpyergpdptedsieairgpfsvatervssfasgfgggtiyypretdegtfgavav
    apgftasqgsmswygervasqgfivftidtntrldqpgqrgrqllaaldylversdrkvr
    erldpnrlavmghamggggsleatvmrpslkasipltpwnldktwgqvqvptfiigaeld
    tiapvsthakpfyeslpsslpkaymeldgathfapnipnttiakyviswlkrfvdedtry
    sqflcpnptdraieeyrstcpykln
    

    Sequence, based on observed residues (ATOM records): (download)
    >5znoA (A:)
    dnpyergpdptedsieairgpfsvatervssfasgfgggtiyypretdegtfgavavapg
    ftasqgsmswygervasqgfivftidtntrldqpgqrgrqllaaldylversdrkvrerl
    dpnrlavmghamggggsleatvmrpslkasipltpwnldktwgqvqvptfiigaeldtia
    pvsthakpfyeslpsslpkaymeldgathfapnipnttiakyviswlkrfvdedtrysqf
    lcpnptdraieeyrstcpyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5znoB (B:)
    gpqdnpyergpdptedsieairgpfsvatervssfasgfgggtiyypretdegtfgavav
    apgftasqgsmswygervasqgfivftidtntrldqpgqrgrqllaaldylversdrkvr
    erldpnrlavmghamggggsleatvmrpslkasipltpwnldktwgqvqvptfiigaeld
    tiapvsthakpfyeslpsslpkaymeldgathfapnipnttiakyviswlkrfvdedtry
    sqflcpnptdraieeyrstcpykln
    

    Sequence, based on observed residues (ATOM records): (download)
    >5znoB (B:)
    dnpyergpdptedsieairgpfsvatervssfasgfgggtiyypretdegtfgavavapg
    ftasqgsmswygervasqgfivftidtntrldqpgqrgrqllaaldylversdrkvrerl
    dpnrlavmghamggggsleatvmrpslkasipltpwnldktwgqvqvptfiigaeldtia
    pvsthakpfyeslpsslpkaymeldgathfapnipnttiakyviswlkrfvdedtrysqf
    lcpnptdraieeyrstcpykl