PDB entry 5zni

View 5zni on RCSB PDB site
Description: Plasmodium falciparum purine nucleoside phosphorylase in complex with mefloquine
Class: transferase
Keywords: transferase, nucleoside phosphorylase
Deposited on 2018-04-09, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine nucleoside phosphorylase
    Species: Plasmodium falciparum [TaxId:5833]
    Gene: PNP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5znia_
  • Heterogens: YMZ, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zniA (A:)
    mdnllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkfl
    cvshgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshl
    lihgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaav
    vemelatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacakl
    atkya
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zniA (A:)
    nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
    shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli
    hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavve
    melatlmvigtlrkvktggilivdgcpfkhqlenmikialgacaklatkya