PDB entry 5znh

View 5znh on RCSB PDB site
Description: Catechol 2,3-dioxygenase with 4-methyl catechol from Diaphorobacter sp DS2
Class: oxidoreductase
Keywords: complex with 4-methylcatechol, OXIDOREDUCTASE
Deposited on 2018-04-09, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catechol 2,3-dioxygenase, extradiol protein
    Species: Diaphorobacter sp. DS2 [TaxId:1302548]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZNH (0-313)
    Domains in SCOPe 2.07: d5znha1, d5znha2
  • Heterogens: FE, MCT, PEG, EDO, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5znhA (A:)
    mgvlrighaslkvmdmdaavrhyenvlgmkttmkdkagnvylkcwdewdkysviltpsdq
    agmnhlaykvekeadlealqqkieawgvkttmldegtlpstgrmlqfklpsghemrlyas
    kefvgtdvgninpdpwpdglkgagahwldhcllvcemnpeagintvadntrfvtecldff
    lteqvlvgpggsiqattflartttphdiafvggptsglhhiaffldswhdvlkaadvmak
    nkvridvaptrhgitrgetiyffdpsgnrnetfaglgylaqrdrpvttwtedqlgsaify
    htgylepsftdvyt