PDB entry 5znd

View 5znd on RCSB PDB site
Description: 8-mer nanotube derived from 24-mer rHuHF nanocage
Class: metal binding protein
Keywords: Ferritin, rHuHF, protein redesign, nanotube, METAL BINDING PROTEIN
Deposited on 2018-04-09, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • engineered mutation (86)
    Domains in SCOPe 2.07: d5znda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zndA (A:)
    mttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqs
    heerehaeklmklqnqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhk
    latdkndphlcdfi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zndA (A:)
    qdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheerehaeklmklq
    nqrggriflqdiqkpdcddwesglnamecalhleknvnqsllelhklatdkndphlcdf