PDB entry 5zn9

View 5zn9 on RCSB PDB site
Description: Crystal structure of PX domain
Class: lipid binding protein
Keywords: PX, lipid, vesicle, retromer, LIPID BINDING PROTEIN
Deposited on 2018-04-08, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sorting nexin-27
    Species: Homo sapiens [TaxId:9606]
    Gene: SNX27, KIAA0488, My014
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zn9a_
  • Chain 'B':
    Compound: Sorting nexin-27
    Species: Homo sapiens [TaxId:9606]
    Gene: SNX27, KIAA0488, My014
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zn9b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zn9A (A:)
    dytekqavpisvprykhveqngekfvvynvymagrqlcskryrefailhqnlkrefanft
    fprlpgkwpfslseqqldarrrgleeylekvcsirvigesdimqeflses
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zn9A (A:)
    avpisvprykhvkfvvynvymagrqlcskryrefailhqnlkrefanftfprlpgkwpfs
    lseqqldarrrgleeylekvcsirvigesdimqeflses
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zn9B (B:)
    dytekqavpisvprykhveqngekfvvynvymagrqlcskryrefailhqnlkrefanft
    fprlpgkwpfslseqqldarrrgleeylekvcsirvigesdimqeflses
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zn9B (B:)
    vpisvprykhveqngekfvvynvymagrqlcskryrefailhqnlkrefanftfprlpgk
    wpfslseqqldarrrgleeylekvcsirvigesdimqeflse