PDB entry 5zn8

View 5zn8 on RCSB PDB site
Description: Crystal structure of nicotinamidase PncA from Bacillus subtilis
Class: metal binding protein
Keywords: Nicotinamidase, PncA, Bacillus subtilis, METAL BINDING PROTEIN
Deposited on 2018-04-08, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isochorismatase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BMJ37_14840
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2D3DSA4 (0-182)
      • engineered mutation (4)
    Domains in SCOPe 2.07: d5zn8a_
  • Chain 'B':
    Compound: Isochorismatase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BMJ37_14840
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A2D3DSA4 (0-182)
      • engineered mutation (4)
    Domains in SCOPe 2.07: d5zn8b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zn8A (A:)
    mkkalicidytndfaaengaltcgeparqiedtivsltqafiengdyvvfavdshdaddd
    fhpetrlfpphningtegkelygrlsplyekhkhaknvnymektrysafagtdlelklre
    rqitelhlaglctdicvlhtavdaynkgfqivihqnavasfnpeghewalshfknsigaq
    vae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zn8A (A:)
    mkkalicidytndfaaengaltcgeparqiedtivsltqafiengdyvvfavdshadddf
    hpetrlfpphningtegkelygrlsplyekhkhaknvnymektrysafagtdlelklrer
    qitelhlaglctdicvlhtavdaynkgfqivihqnavasfnpeghewalshfknsigaqv
    ae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zn8B (B:)
    mkkalicidytndfaaengaltcgeparqiedtivsltqafiengdyvvfavdshdaddd
    fhpetrlfpphningtegkelygrlsplyekhkhaknvnymektrysafagtdlelklre
    rqitelhlaglctdicvlhtavdaynkgfqivihqnavasfnpeghewalshfknsigaq
    vae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zn8B (B:)
    mkkalicidytndfaaengaltcgeparqiedtivsltqafiengdyvvfavdshdddfh
    petrlfpphningtegkelygrlsplyekhkhaknvnymektrysafagtdlelklrerq
    itelhlaglctdicvlhtavdaynkgfqivihqnavasfnpeghewalshfknsigaqva
    e