PDB entry 5zn3

View 5zn3 on RCSB PDB site
Description: X-ray structure of protein kinase ck2 alpha subunit H148S mutant
Class: transferase
Keywords: kinase, ck2, human, casein, TRANSFERASE
Deposited on 2018-04-07, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Casein kinase II subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: CSNK2A1, CK2A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68400 (Start-328)
      • engineered mutation (146-147)
      • engineered mutation (219)
    Domains in SCOPe 2.07: d5zn3a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zn3A (A:)
    msgpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainit
    nnekvvvkilkpvkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntd
    fkqlyqtltdydirfymyeilkaldyassmgimhrdvkphnvmidhehrklrlidwglae
    fyhpgqeynvrvasryfkgpellvdyqmydysldmwslgamlasmifrkepffhghdnyd
    qlvriakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdf
    ldkllrydhqsrltareamehpyfytvvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zn3A (A:)
    gpvpsrarvytdvnthrpreywdyeshvvewgnqddyqlvrklgrgkysevfeainitnn
    ekvvvkilkkkkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfkqly
    qtltdydirfymyeilkaldyassmgimhrdvkphnvmidhehrklrlidwglaefyhpg
    qeynvrvasryfkgpellvdyqmydysldmwslgamlasmifrkepffhghdnydqlvri
    akvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldkll
    rydhqsrltareamehpyfytvvk