PDB entry 5zmj

View 5zmj on RCSB PDB site
Description: Crystal structure of the Fab region of a neutralizing fully human antibody against GM-CSF
Class: immune system
Keywords: Fab, fully human antibody, GM-CSF, IMMUNE SYSTEM
Deposited on 2018-04-04, released 2019-04-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy chain of a Fab fraction of human IgG
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZMJ
    Domains in SCOPe 2.08: d5zmjh_
  • Chain 'L':
    Compound: Light chain of a Fab fraction of human IgG
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZMJ
    Domains in SCOPe 2.08: d5zmjl1, d5zmjl2
  • Heterogens: SO4, NA, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5zmjH (H:)
    mdwtwrilflvaaatgapsqvhlvqsgselkkpgasvkvsckasgysfsrygikwvrqap
    gqglewmgwintrsgvpayaqgftgrfvfsldtsvdtafleisslktedtgiyycatrpp
    rfydkteywedgfdvwgrgtlvtvssastkgpsvfplapsskstsggtaalgclvkdyfp
    epvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkv
    dkrvepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zmjH (H:)
    qvhlvqsgselkkpgasvkvsckasgysfsrygikwvrqapgqglewmgwintrsgvpay
    aqgftgrfvfsldtsvdtafleisslktedtgiyycatrpprfydkteywedgfdvwgrg
    tlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtf
    pavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5zmjL (L:)
    magfpllltllthcagswaqsvltqppsasgtpgqsvniscsgsssnignsyvywyqqlp
    gtapklliyrnnrrpsgvpdrfsgsksdtsaslaisglrsedeadyycatwddslsgrlf
    gggtkltvlgqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvka
    gvetttpskqsnnkyaassylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zmjL (L:)
    svltqppsasgtpgqsvniscsgsssnignsyvywyqqlpgtapklliyrnnrrpsgvpd
    rfsgsksdtsaslaisglrsedeadyycatwddslsgrlfgggtkltvlgqpkaapsvtl
    fppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassy
    lsltpeqwkshrsyscqvthegstvektvap