PDB entry 5zm9

View 5zm9 on RCSB PDB site
Description: Crystal structure of hexacoordinated heme protein from anhydrobiotic tardigrade at pH 7
Class: oxygen transport
Keywords: Globin, Tardigrade, OXYGEN TRANSPORT
Deposited on 2018-04-02, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Compound: Globin protein
    Species: Ramazzottius varieornatus [TaxId:947166]
    Gene: RvY_09119-1, RvY_09119.1, RvY_09119
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zm9d_
  • Heterogens: HEM, CL, HOH

PDB Chain Sequences:

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zm9D (D:)
    mgsshhhhhhenlyfqsdprfpltardkfslvkswktfsrnlesagkemllklfiehpdm
    kdlfpkfkaktpdqlrndesfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvp
    gfqesyfermekclvfalqttladaytenmeriykiwiswttekiregfre
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zm9D (D:)
    dprfpltardkfslvkswktfsrnlesagkemllklfiehpdmkdlfpkfkaktpdqlrn
    desfeeaalahitpydqavqdsdnvdilltnlkrvgrqhktvpgfqesyfermekclvfa
    lqttladaytenmeriykiwiswttekiregfre