PDB entry 5zm0

View 5zm0 on RCSB PDB site
Description: X-ray structure of animal-like Cryptochrome from Chlamydomonas reinhardtii
Class: flavoprotein
Keywords: Cryptochrome, Photolyase, Photoreceptor, FLAVOPROTEIN
Deposited on 2018-03-31, released 2018-07-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cryptochrome photoreceptor
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: UVR3, CHLRE_06g278251v5, CHLREDRAFT_206002
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zm0a1, d5zm0a2
  • Heterogens: FAD, GOL, MES, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zm0A (A:)
    magvknsiiwfrkglrlhdnpalleackdakhvypvfvldphflqqssykvsvnrynfll
    esledlqrsfqargsrllvlrgkpeevfprvfrewgvtqlcfehdtepyakvrdaavrrl
    aaeagvevvtpishtlydtdmlvarnggaapltmqsftklvdrvgdppapapdppaampp
    paedmpsaapaatgvptwqevgfkeppltvfkggetealarleaafqdpkwvagfqkpdt
    dpsawekpattvlspylkfgclsarlfharllevyrrhpahsqppvslrgqllwreffyt
    vgsttpnfhrmagnpvckqidwddnpeflaawreartgfpwidaimtqlvtwgwmhhlar
    hsvacfltrgdlyvswergmevfeehlidqdhylnaanwmwlsasaffsqyfrvyspvvf
    gkkydpegrfirkflpvlkdmpakyiyepwtaplevqrkagcvvgrdypapivdhavask
    aciarmaaayrrskgeklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zm0A (A:)
    gvknsiiwfrkglrlhdnpalleackdakhvypvfvldphflqqsykvsvnrynfllesl
    edlqrsfqargsrllvlrgkpeevfprvfrewgvtqlcfehdtepyakvrdaavrrlaae
    agvevvtpishtlydtdmlvarnggaapltmqsftklvdrvgdppapapdppaampppae
    dmpsaapaatgvptwqevgfkeppltvfkggetealarleaafqdpkwvagfqkpdtdps
    awekpattvlspylkfgclsarlfharllevyrrhpahsqppvslrgqllwreffytvgs
    ttpnfhrmagnpvckqidwddnpeflaawreartgfpwidaimtqlvtwgwmhhlarhsv
    acfltrgdlyvswergmevfeehlidqdhylnaanwmwlsasaffsqyfrvyspvvfgkk
    ydpegrfirkflpvlkdmpakyiyepwtaplevqrkagcvvgrdypapivdhavaskaci
    armaaayrrsk