PDB entry 5zlt

View 5zlt on RCSB PDB site
Description: Crystal structure of UDP-GlcNAc 2-epimerase NeuC complexed with UDP
Class: hydrolase
Keywords: NeuC, UDP N-acetylglucosamine 2-epimerase, HYDROLASE
Deposited on 2018-03-29, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP/UDP-N,N'-diacetylbacillosamine 2-epimerase (Hydrolyzing)
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: legG, neuC, CAS83_20140, CUC62_14590, CV949_00455, LV38_02406
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zlta1, d5zlta2
  • Chain 'B':
    Compound: GDP/UDP-N,N'-diacetylbacillosamine 2-epimerase (Hydrolyzing)
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: legG, neuC, CAS83_20140, CUC62_14590, CV949_00455, LV38_02406
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zltb1, d5zltb2
  • Chain 'C':
    Compound: GDP/UDP-N,N'-diacetylbacillosamine 2-epimerase (Hydrolyzing)
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: legG, neuC, CAS83_20140, CUC62_14590, CV949_00455, LV38_02406
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zltc1, d5zltc2
  • Chain 'D':
    Compound: GDP/UDP-N,N'-diacetylbacillosamine 2-epimerase (Hydrolyzing)
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: legG, neuC, CAS83_20140, CUC62_14590, CV949_00455, LV38_02406
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zltd1, d5zltd2
  • Heterogens: UDP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zltA (A:)
    mkkiavftgtraeygllywlmrdiqqdpelelqilatamhyspehgetwktivkdgfeit
    esvemllssdtssavvksmgvgllgfadalkrmqpdvlvvlgdrfealavtqaalimhvp
    vahlhggeitegaydesirhaitkmsnihfaaaeeykkriiqlgeqpervfnvgalgldh
    iqrttfksiselselydfdfskpyflityhpetnlleenvaplfdalkqindvnfifsyp
    nadngntnivkamldlkaqlpdrvllvksfgiqnylsvlknalamvgnsssglseapalq
    vptvnigdrqkgrlrcesildvrldeneivealqkainfpkdqlsqvvpplglgntsqki
    ievikttdfkkkapfydlle
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zltA (A:)
    mkkiavftgtraeygllywlmrdiqqdpelelqilatamhyspehgetwktivkdgfeit
    esvemllssdtssavvksmgvgllgfadalkrmqpdvlvvlgdrfealavtqaalimhvp
    vahlhggeitegaydesirhaitkmsnihfaaaeeykkriiqlgeqpervfnvgalgldh
    iqrttfksiselselydfdfskpyflityhpetnlleenvaplfdalkqindvnfifsyp
    nadngntnivkamldlkaqlpdrvllvksfgiqnylsvlknalamvgnsssglseapalq
    vptvnigdrqkgrlrcesildvrldeneivealqkainfpplglgntsqkiievikttdf
    kkkapfydll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zltB (B:)
    mkkiavftgtraeygllywlmrdiqqdpelelqilatamhyspehgetwktivkdgfeit
    esvemllssdtssavvksmgvgllgfadalkrmqpdvlvvlgdrfealavtqaalimhvp
    vahlhggeitegaydesirhaitkmsnihfaaaeeykkriiqlgeqpervfnvgalgldh
    iqrttfksiselselydfdfskpyflityhpetnlleenvaplfdalkqindvnfifsyp
    nadngntnivkamldlkaqlpdrvllvksfgiqnylsvlknalamvgnsssglseapalq
    vptvnigdrqkgrlrcesildvrldeneivealqkainfpkdqlsqvvpplglgntsqki
    ievikttdfkkkapfydlle
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zltB (B:)
    mkkiavftgtraeygllywlmrdiqqdpelelqilatamhyspehgetwktivkdgfeit
    esvemllssdtssavvksmgvgllgfadalkrmqpdvlvvlgdrfealavtqaalimhvp
    vahlhggeitegaydesirhaitkmsnihfaaaeeykkriiqlgeqpervfnvgalgldh
    iqrttfksiselselydfdfskpyflityhpetnlleenvaplfdalkqindvnfifsyp
    nadngntnivkamldlkaqlpdrvllvksfgiqnylsvlknalamvgnsssglseapalq
    vptvnigdrqkgrlrcesildvrldeneivealqkainflgntsqkiievikttdfkkka
    pfydll
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zltC (C:)
    mkkiavftgtraeygllywlmrdiqqdpelelqilatamhyspehgetwktivkdgfeit
    esvemllssdtssavvksmgvgllgfadalkrmqpdvlvvlgdrfealavtqaalimhvp
    vahlhggeitegaydesirhaitkmsnihfaaaeeykkriiqlgeqpervfnvgalgldh
    iqrttfksiselselydfdfskpyflityhpetnlleenvaplfdalkqindvnfifsyp
    nadngntnivkamldlkaqlpdrvllvksfgiqnylsvlknalamvgnsssglseapalq
    vptvnigdrqkgrlrcesildvrldeneivealqkainfpkdqlsqvvpplglgntsqki
    ievikttdfkkkapfydlle
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zltC (C:)
    mkkiavftgtraeygllywlmrdiqqdpelelqilatamhyspehgetwktivkdgfeit
    esvemllssdtssavvksmgvgllgfadalkrmqpdvlvvlgdrfealavtqaalimhvp
    vahlhggeitegaydesirhaitkmsnihfaaaeeykkriiqlgeqpervfnvgalgldh
    iqrttfksiselselydfdfskpyflityhpetnlleenvaplfdalkqindvnfifsyp
    nadngntnivkamldlkaqlpdrvllvksfgiqnylsvlknalamvgnsssglseapalq
    vptvnigdrqkgrlrcesildvrldeneivealqkainfpplglgntsqkiievikttdf
    kkkapfydll
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zltD (D:)
    mkkiavftgtraeygllywlmrdiqqdpelelqilatamhyspehgetwktivkdgfeit
    esvemllssdtssavvksmgvgllgfadalkrmqpdvlvvlgdrfealavtqaalimhvp
    vahlhggeitegaydesirhaitkmsnihfaaaeeykkriiqlgeqpervfnvgalgldh
    iqrttfksiselselydfdfskpyflityhpetnlleenvaplfdalkqindvnfifsyp
    nadngntnivkamldlkaqlpdrvllvksfgiqnylsvlknalamvgnsssglseapalq
    vptvnigdrqkgrlrcesildvrldeneivealqkainfpkdqlsqvvpplglgntsqki
    ievikttdfkkkapfydlle
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zltD (D:)
    mkkiavftgtraeygllywlmrdiqqdpelelqilatamhyspehgetwktivkdgfeit
    esvemllssdtssavvksmgvgllgfadalkrmqpdvlvvlgdrfealavtqaalimhvp
    vahlhggeitegaydesirhaitkmsnihfaaaeeykkriiqlgeqpervfnvgalgldh
    iqrttfksiselselydfdfskpyflityhpetnlleenvaplfdalkqindvnfifsyp
    nadngntnivkamldlkaqlpdrvllvksfgiqnylsvlknalamvgnsssglseapalq
    vptvnigdrqkgrlrcesildvrldeneivealqkainflgntsqkiievikttdfkkka
    pfydll