PDB entry 5zlk

View 5zlk on RCSB PDB site
Description: Mutation in the trinuclear site of CotA-laccase: H493A mutant, PH 8.0
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2018-03-28, released 2018-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spore coat protein a
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: cotA, pig, BSU06300
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07788
      • engineered mutation (492)
    Domains in SCOPe 2.08: d5zlka1, d5zlka2, d5zlka3
  • Heterogens: CU, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zlkA (A:)
    mtlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgpti
    evkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgype
    awfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkek
    rlklpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvw
    pyleveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaery
    diiidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasyps
    vqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthp
    ihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaat
    fgpysgryvwhcailehedydmmrpmditdphk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zlkA (A:)
    tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
    vkrnenvyvkwmnnlpsthflpidhtihhseepevktvvhlhggvtpddsdgypeawfsk
    dfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrlklp
    sdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpylev
    eprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydiiid
    ftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasypsvqher
    iqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthpihlhl
    vsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaatfgpys
    gryvwhcailehedydmmrpmditdp