PDB entry 5zkv

View 5zkv on RCSB PDB site
Description: Solution structure of molten globule state of L94G mutant of horse cytochrome-c
Class: electron transport
Keywords: Structure from MOLMOL, ELECTRON TRANSPORT
Deposited on 2018-03-26, released 2019-05-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Equus caballus [TaxId:9796]
    Gene: CYCS, CYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00004 (0-103)
      • engineered mutation (93)
    Domains in SCOPe 2.07: d5zkva_
  • Heterogens: HEC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zkvA (A:)
    gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqapgftytdanknkgitwk
    eetlmeylenpkkyipgtkmifagikkkteredgiaylkkatne