PDB entry 5zkn

View 5zkn on RCSB PDB site
Description: Structure of N-acetylmannosamine-6-phosphate 2-epimerase from Fusobacterium nucleatum
Class: isomerase
Keywords: Sialic acid catabolic pathway Epimerase, ISOMERASE
Deposited on 2018-03-24, released 2018-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-19, with a file datestamp of 2018-09-14.
Experiment type: XRAY
Resolution: 2.21 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative N-acetylmannosamine-6-phosphate 2-epimerase
    Species: Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [TaxId:190304]
    Gene: nanE, FN1476
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RDN5 (17-240)
      • expression tag (16)
    Domains in SCOPe 2.07: d5zkna1, d5zkna2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zknA (A:)
    mhhhhhhitslykkagfmnkilesirgklivscqaledeplhssfimgrmayaaysggaa
    girantvedikeikknvslpiigiikkvynnsdvyitptikevedlinegvqiiaidatk
    rerpdrkdlknfiaeikekypnqlfmadissvdealyaekigfdivgttlvgytdytkny
    kaleelkkvvkvvkipviaegnidtplkakkaleigafavvvggaitrpqqitkkfvdem
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zknA (A:)
    fmnkilesirgklivscqaledeplhssfimgrmayaaysggaagirantvedikeikkn
    vslpiigiikkvynnsdvyitptikevedlinegvqiiaidatkrerpdrkdlknfiaei
    kekypnqlfmadissvdealyaekigfdivgttlvgytdytknykaleelkkvvkvvkip
    viaegnidtplkakkaleigafavvvggaitrpqqitkkfvdemk