PDB entry 5zkk

View 5zkk on RCSB PDB site
Description: Crystal structure of Phosphoserine phosphatase from Entamoeba histolytica
Class: hydrolase
Keywords: Histidine phosphatase superfamily memeber, Phosphatase, cysteine biosynthetic pathway, BIOSYNTHETIC PROTEIN, HYDROLASE
Deposited on 2018-03-24, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoglycerate mutase family protein, putative
    Species: Entamoeba histolytica HM-1:IMSS-A [TaxId:885318]
    Gene: EHI7A_041450
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zkka_
  • Chain 'B':
    Compound: Phosphoglycerate mutase family protein, putative
    Species: Entamoeba histolytica HM-1:IMSS-A [TaxId:885318]
    Gene: EHI7A_041450
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zkkb_
  • Heterogens: BME, PO4, PEG, 144, GOL, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zkkA (A:)
    mtklilirhgetewnllgkiqgctdieltpngiqqanevaqqikgnfdiiyssplhrali
    taqkiagdkevhliegmkeipfgtweghtfeelngdinykkflsgedgcpfdstgmsias
    wskknaqllldlckqnenktivcvshgawiktsilgllemeptmyhkfqlgntgittfif
    rhghpvltsfnstqhlltenksktghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zkkA (A:)
    mtklilirhgetewnllgkiqgctdieltpngiqqanevaqqikgnfdiiyssplhrali
    taqkiagdkevhliegmkeipfgtweghtfeelngdinykkflsgedgcpfdstgmsias
    wskknaqllldlckqnenktivcvshgawiktsilgllemeptmyhkfqlgntgittfif
    rhghpvltsfnstqhll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zkkB (B:)
    mtklilirhgetewnllgkiqgctdieltpngiqqanevaqqikgnfdiiyssplhrali
    taqkiagdkevhliegmkeipfgtweghtfeelngdinykkflsgedgcpfdstgmsias
    wskknaqllldlckqnenktivcvshgawiktsilgllemeptmyhkfqlgntgittfif
    rhghpvltsfnstqhlltenksktghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zkkB (B:)
    mtklilirhgetewnllgkiqgctdieltpngiqqanevaqqikgnfdiiyssplhrali
    taqkiagdkevhliegmkeipfgtweghtfeelngdinykkflsgedgcpfdstgmsias
    wskknaqllldlckqnenktivcvshgawiktsilgllemeptmyhkfqlgntgittfif
    rhghpvltsfnstqhll