PDB entry 5zk0

View 5zk0 on RCSB PDB site
Description: Crystal structure of Peptidyl-tRNA hydrolase mutant -M71A from Vibrio cholerae
Class: hydrolase
Keywords: Peptidyl-tRNA hydrolase, Mutant M71A, HYDROLASE
Deposited on 2018-03-22, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: pth, VC_2184
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQ21 (2-198)
      • insertion (3)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d5zk0a_
  • Chain 'B':
    Compound: Peptidyl-tRNA hydrolase
    Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) [TaxId:243277]
    Gene: pth, VC_2184
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQ21 (2-198)
      • insertion (3)
      • engineered mutation (72)
    Domains in SCOPe 2.07: d5zk0b_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zk0A (A:)
    gamvsqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllin
    sqelrvlipttfanlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghn
    glkdtisklgnnkefyrlrlgighpghkdkvagyvlgkapakeqexldaavdesvrclei
    lmkdgltkaqnrlhtfkae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zk0A (A:)
    mvsqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsq
    elrvlipttfanlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghngl
    kdtisklgnnkefyrlrlgighpkvagyvlgkapakeqexldaavdesvrcleilmkdgl
    tkaqnrlhtfkae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zk0B (B:)
    gamvsqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllin
    sqelrvlipttfanlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghn
    glkdtisklgnnkefyrlrlgighpghkdkvagyvlgkapakeqexldaavdesvrclei
    lmkdgltkaqnrlhtfkae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zk0B (B:)
    mvsqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsq
    elrvlipttfanlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghngl
    kdtisklgnnkefyrlrlgighpghkdkvagyvlgkapakeqexldaavdesvrcleilm
    kdgltkaqnrlhtfkae