PDB entry 5zjw

View 5zjw on RCSB PDB site
Description: Crystal Structure of PAK4 in complex with inhibitor CZg353
Class: transferase
Keywords: ATP binding pocket, TRANSFERASE
Deposited on 2018-03-22, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase pak 4
    Species: Homo sapiens [TaxId:9606]
    Gene: PAK4, KIAA1142
    Database cross-references and differences (RAF-indexed):
    • Uniprot O96013 (1-292)
      • expression tag (0)
    Domains in SCOPe 2.07: d5zjwa1, d5zjwa2
  • Heterogens: 9EO, EDO, TRS, BCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zjwA (A:)
    ssheqfraalqlvvdpgdprsyldnfikigegstgivciatvrssgklvavkkmdlrkqq
    rrellfnevvimrdyqhenvvemynsylvgdelwvvmefleggaltdivthtrmneeqia
    avclavlqalsvlhaqgvihrdiksdsillthdgrvklsdfgfcaqvskevprrkslvgt
    pywmapelisrlpygpevdiwslgimviemvdgeppyfnepplkamkmirdnlpprlknl
    hkvspslkgfldrllvrdpaqrataaellkhpflakagppasivplmrqnrtr