PDB entry 5zjf

View 5zjf on RCSB PDB site
Description: ldha-ma
Class: oxidoreductase
Keywords: LDHA, inhibitor, machilin a, OXIDOREDUCTASE
Deposited on 2018-03-20, released 2019-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zjfa1, d5zjfa2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zjfb1, d5zjfb2
  • Chain 'C':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zjfc1, d5zjfc2
  • Chain 'D':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zjfd1, d5zjfd2
  • Chain 'E':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zjfe1, d5zjfe2
  • Chain 'F':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zjff1, d5zjff2
  • Chain 'G':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zjfg1, d5zjfg2
  • Chain 'H':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zjfh1, d5zjfh2
  • Chain 'I':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zjfi1, d5zjfi2
  • Chain 'J':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zjfj1, d5zjfj2
  • Chain 'K':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zjfk1, d5zjfk2
  • Chain 'L':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zjfl1, d5zjfl2
  • Heterogens: 9G9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zjfA (A:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjfA (A:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zjfB (B:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjfB (B:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zjfC (C:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjfC (C:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zjfD (D:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjfD (D:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5zjfE (E:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjfE (E:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5zjfF (F:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjfF (F:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5zjfG (G:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjfG (G:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5zjfH (H:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjfH (H:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5zjfI (I:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjfI (I:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5zjfJ (J:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjfJ (J:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5zjfK (K:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjfK (K:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5zjfL (L:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjfL (L:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf