PDB entry 5zje

View 5zje on RCSB PDB site
Description: LDHA-mla
Class: oxidoreductase
Keywords: LDHA wt, malonate, OXIDOREDUCTASE
Deposited on 2018-03-20, released 2019-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.93 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjea1, d5zjea2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjeb1, d5zjeb2
  • Chain 'C':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjec1, d5zjec2
  • Chain 'D':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjed1, d5zjed2
  • Chain 'E':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjee1, d5zjee2
  • Chain 'F':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjef1, d5zjef2
  • Chain 'G':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjeg1, d5zjeg2
  • Chain 'H':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjeh1, d5zjeh2
  • Chain 'I':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjei1, d5zjei2
  • Chain 'J':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjej1, d5zjej2
  • Chain 'K':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjek1, d5zjek2
  • Chain 'L':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjel1, d5zjel2
  • Heterogens: MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zjeA (A:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjeA (A:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zjeB (B:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjeB (B:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zjeC (C:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjeC (C:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zjeD (D:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjeD (D:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5zjeE (E:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjeE (E:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5zjeF (F:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjeF (F:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5zjeG (G:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjeG (G:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5zjeH (H:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjeH (H:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5zjeI (I:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjeI (I:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5zjeJ (J:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjeJ (J:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5zjeK (K:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjeK (K:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5zjeL (L:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjeL (L:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf