PDB entry 5zjd

View 5zjd on RCSB PDB site
Description: Lactate dehydrogenase with NADH and MLA
Class: oxidoreductase
Keywords: LDHA, NADH, Oxidoreductase
Deposited on 2018-03-20, released 2019-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjda1, d5zjda2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjdb1, d5zjdb2
  • Chain 'C':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjdc1, d5zjdc2
  • Chain 'D':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjdd1, d5zjdd2
  • Chain 'E':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjde1, d5zjde2
  • Chain 'F':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjdf1, d5zjdf2
  • Chain 'G':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjdg1, d5zjdg2
  • Chain 'H':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zjdh1, d5zjdh2
  • Heterogens: MLI, NAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zjdA (A:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjdA (A:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zjdB (B:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjdB (B:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zjdC (C:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjdC (C:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zjdD (D:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjdD (D:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5zjdE (E:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjdE (E:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5zjdF (F:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjdF (F:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5zjdG (G:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjdG (G:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5zjdH (H:)
    hhhhhhatlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdvie
    dklkgemmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvn
    ifkfiipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmg
    erlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvv
    esayeviklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcil
    gqngisdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zjdH (H:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf