PDB entry 5zj6

View 5zj6 on RCSB PDB site
Description: Crystal structure of HCK kinase complexed with a pyrrolo-pyrimidine inhibitor 7-[trans-4-(4-methylpiperazin-1-yl)cyclohexyl]-5-(4-phenoxyphenyl)-7H-pyrrolo[2,3-d]pyrimidin-4-amine
Class: transferase
Keywords: kinase/Kinase inhibitor, TRANSFERASE
Deposited on 2018-03-19, released 2018-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase HCK
    Species: Homo sapiens [TaxId:9606]
    Gene: HCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zj6a_
  • Chain 'B':
    Compound: Tyrosine-protein kinase HCK
    Species: Homo sapiens [TaxId:9606]
    Gene: HCK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zj6b_
  • Heterogens: VSE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zj6A (A:)
    gssgssgmsskpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkp
    gsmsveaflaeanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqp
    lpklidfsaqiaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytar
    egakfpikwtapeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergy
    rmprpencpeelynimmrcwknrpeerptfeyiqsvlddfytatesq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zj6A (A:)
    kpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaean
    vmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiae
    gmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwtape
    ainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeely
    nimmrcwknrpeerptfeyiqsvlddfytat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zj6B (B:)
    gssgssgmsskpqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkp
    gsmsveaflaeanvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqp
    lpklidfsaqiaegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytar
    egakfpikwtapeainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergy
    rmprpencpeelynimmrcwknrpeerptfeyiqsvlddfytatesq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zj6B (B:)
    pwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaeanv
    mktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiaeg
    mafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwtapea
    infgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelyn
    immrcwknrpeerptfeyiqsvlddfytat