PDB entry 5zj3

View 5zj3 on RCSB PDB site
Description: Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From pichia expression system
Class: hydrolase inhibitor
Keywords: Textilinin-1, A Kunitz-Type Serine Protease Inhibitor From, HYDROLASE INHIBITOR
Deposited on 2018-03-19, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kunitz-type serine protease inhibitor textilinin-1
    Species: Pseudonaja textilis textilis [TaxId:169397]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zj3a_
  • Chain 'B':
    Compound: Kunitz-type serine protease inhibitor textilinin-1
    Species: Pseudonaja textilis textilis [TaxId:169397]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zj3b_
  • Chain 'C':
    Compound: Kunitz-type serine protease inhibitor textilinin-1
    Species: Pseudonaja textilis textilis [TaxId:169397]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zj3c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zj3A (A:)
    kdrpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestcaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zj3A (A:)
    rpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestca
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zj3B (B:)
    kdrpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestcaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zj3B (B:)
    kdrpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestca
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zj3C (C:)
    kdrpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestcaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zj3C (C:)
    rpdfcelpadtgpcrvrfpsfyynpdekkclefiyggcegnannfitkeecestca