PDB entry 5zig

View 5zig on RCSB PDB site
Description: The Structure of cellobiose 2-epimerase from Spirochaeta thermophila DSM 6192
Class: isomerase
Keywords: Cellobiose 2-epimerase, isomerization, epimerization, lactose, BIOSYNTHETIC PROTEIN, ISOMERASE
Deposited on 2018-03-15, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellobiose 2-epimerase
    Species: Spirochaeta thermophila DSM 6192 [TaxId:665571]
    Gene: STHERM_c00950
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ziga_
  • Chain 'B':
    Compound: Cellobiose 2-epimerase
    Species: Spirochaeta thermophila DSM 6192 [TaxId:665571]
    Gene: STHERM_c00950
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zigb_
  • Chain 'C':
    Compound: Cellobiose 2-epimerase
    Species: Spirochaeta thermophila DSM 6192 [TaxId:665571]
    Gene: STHERM_c00950
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zigc_
  • Chain 'D':
    Compound: Cellobiose 2-epimerase
    Species: Spirochaeta thermophila DSM 6192 [TaxId:665571]
    Gene: STHERM_c00950
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zigd_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zigA (A:)
    mplpttlrptlrqirselaaqlfdhilpfwlgqqdpihggfygsittgpdptapkglvmt
    arhlwtfsqaflsrpnpayleaagnayrflthalydathrgffwsvhpdgtplsrvkkly
    gnafavyalaayhtasgdrealtlawetfdlledrgrdrrhggyyeaftedwstplpepl
    gegetpapktmnthlhileaystlfrttkeprvreamehlilifrthiapsshlglyfae
    dwapmgggisfghdieatwlltesvellygdplpewflswirpvmeetaraldthggslp
    neqredgsvdrarvwwvqaeafvgflnayslfeepryldhactvwrfimdhlvdreggew
    fwavtpegsplagyekggmwkasyhnsraclegmrridtileee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zigB (B:)
    mplpttlrptlrqirselaaqlfdhilpfwlgqqdpihggfygsittgpdptapkglvmt
    arhlwtfsqaflsrpnpayleaagnayrflthalydathrgffwsvhpdgtplsrvkkly
    gnafavyalaayhtasgdrealtlawetfdlledrgrdrrhggyyeaftedwstplpepl
    gegetpapktmnthlhileaystlfrttkeprvreamehlilifrthiapsshlglyfae
    dwapmgggisfghdieatwlltesvellygdplpewflswirpvmeetaraldthggslp
    neqredgsvdrarvwwvqaeafvgflnayslfeepryldhactvwrfimdhlvdreggew
    fwavtpegsplagyekggmwkasyhnsraclegmrridtileee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zigC (C:)
    mplpttlrptlrqirselaaqlfdhilpfwlgqqdpihggfygsittgpdptapkglvmt
    arhlwtfsqaflsrpnpayleaagnayrflthalydathrgffwsvhpdgtplsrvkkly
    gnafavyalaayhtasgdrealtlawetfdlledrgrdrrhggyyeaftedwstplpepl
    gegetpapktmnthlhileaystlfrttkeprvreamehlilifrthiapsshlglyfae
    dwapmgggisfghdieatwlltesvellygdplpewflswirpvmeetaraldthggslp
    neqredgsvdrarvwwvqaeafvgflnayslfeepryldhactvwrfimdhlvdreggew
    fwavtpegsplagyekggmwkasyhnsraclegmrridtileee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zigC (C:)
    pttlrptlrqirselaaqlfdhilpfwlgqqdpihggfygsittgpdptapkglvmtarh
    lwtfsqaflsrpnpayleaagnayrflthalydathrgffwsvhpdgtplsrvkklygna
    favyalaayhtasgdrealtlawetfdlledrgrdrrhggyyeaftedwstplpeplgeg
    etpapktmnthlhileaystlfrttkeprvreamehlilifrthiapsshlglyfaedwa
    pmgggisfghdieatwlltesvellygdplpewflswirpvmeetaraldthggslpneq
    redgsvdrarvwwvqaeafvgflnayslfeepryldhactvwrfimdhlvdreggewfwa
    vtpegsplagyekggmwkasyhnsraclegmrridtile
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zigD (D:)
    mplpttlrptlrqirselaaqlfdhilpfwlgqqdpihggfygsittgpdptapkglvmt
    arhlwtfsqaflsrpnpayleaagnayrflthalydathrgffwsvhpdgtplsrvkkly
    gnafavyalaayhtasgdrealtlawetfdlledrgrdrrhggyyeaftedwstplpepl
    gegetpapktmnthlhileaystlfrttkeprvreamehlilifrthiapsshlglyfae
    dwapmgggisfghdieatwlltesvellygdplpewflswirpvmeetaraldthggslp
    neqredgsvdrarvwwvqaeafvgflnayslfeepryldhactvwrfimdhlvdreggew
    fwavtpegsplagyekggmwkasyhnsraclegmrridtileee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zigD (D:)
    ttlrptlrqirselaaqlfdhilpfwlgqqdpihggfygsittgpdptapkglvmtarhl
    wtfsqaflsrpnpayleaagnayrflthalydathrgffwsvhpdgtplsrvkklygnaf
    avyalaayhtasgdrealtlawetfdlledrgrdrrhggyyeaftedwstplpeplgege
    tpapktmnthlhileaystlfrttkeprvreamehlilifrthiapsshlglyfaedwap
    mgggisfghdieatwlltesvellygdplpewflswirpvmeetaraldthggslpneqr
    edgsvdrarvwwvqaeafvgflnayslfeepryldhactvwrfimdhlvdreggewfwav
    tpegsplagyekggmwkasyhnsraclegmrridtile