PDB entry 5zi9

View 5zi9 on RCSB PDB site
Description: Crystal strcuture of type-II LOG from Streptomyces coelicolor A3
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-03-14, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytokinin riboside 5'-monophosphate phosphoribohydrolase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO5140
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FBL8 (Start-251)
      • expression tag (252)
    Domains in SCOPe 2.07: d5zi9a1, d5zi9a2
  • Chain 'B':
    Compound: Cytokinin riboside 5'-monophosphate phosphoribohydrolase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO5140
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cytokinin riboside 5'-monophosphate phosphoribohydrolase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO5140
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FBL8 (Start-251)
      • expression tag (252)
    Domains in SCOPe 2.07: d5zi9c1, d5zi9c2
  • Chain 'D':
    Compound: Cytokinin riboside 5'-monophosphate phosphoribohydrolase
    Species: Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) [TaxId:100226]
    Gene: SCO5140
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, FLC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zi9A (A:)
    matgnpegkkrppeeqrlgpvlrrrgqvqesttdqrllderaptdwvhtdpwrvlriqse
    fiegfgtlaelppaisvfgsartpadspeydagvrlgrglveagfavitgggpgameaan
    kgaleakgtsvglgielpfeqglnpyvdiglnfryffvrkmmfvkyaqgfvvlpgglgtl
    delfealtlvqtqkvtrfpivlfgseywgglvdwlrgtlvaqgkaaekdlmlfhvtddvd
    eavalvskeagrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zi9A (A:)
    dwvhtdpwrvlriqsefiegfgtlaelppaisvfgsartpadspeydagvrlgrglveag
    favitgggpgameaankgaleakgtsvglgielpfeqglnpyvdiglnfryffvrkmmfv
    kyaqgfvvlpgglgtldelfealtlvqtqkvtrfpivlfgseywgglvdwlrgtlvaqgk
    aaekdlmlfhvtddvdeavalvskeagrl
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zi9C (C:)
    matgnpegkkrppeeqrlgpvlrrrgqvqesttdqrllderaptdwvhtdpwrvlriqse
    fiegfgtlaelppaisvfgsartpadspeydagvrlgrglveagfavitgggpgameaan
    kgaleakgtsvglgielpfeqglnpyvdiglnfryffvrkmmfvkyaqgfvvlpgglgtl
    delfealtlvqtqkvtrfpivlfgseywgglvdwlrgtlvaqgkaaekdlmlfhvtddvd
    eavalvskeagrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zi9C (C:)
    dwvhtdpwrvlriqsefiegfgtlaelppaisvfgsartpadspeydagvrlgrglveag
    favitgggpgameaankgaleakgtsvglgielpfeqglnpyvdiglnfryffvrkmmfv
    kyaqgfvvlpgglgtldelfealtlvqtqkvtrfpivlfgseywgglvdwlrgtlvaqgk
    aaekdlmlfhvtddvdeavalvskeagrl
    

  • Chain 'D':
    No sequence available.