PDB entry 5zi0

View 5zi0 on RCSB PDB site
Description: Ketoreductase LbCR mutant - M8
Class: oxidoreductase
Keywords: ketoreductase, short-chain dehydrogenase/reductase (SDR), OXIDOREDUCTASE
Deposited on 2018-03-14, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-acyl carrier protein reductase
    Species: Lactobacillus brevis (strain ATCC 367 / JCM 1170) [TaxId:387344]
    Gene: LVIS_0330
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03TH6 (Start-280)
      • engineered mutation (185-186)
      • engineered mutation (229)
      • engineered mutation (232-233)
    Domains in SCOPe 2.07: d5zi0a_
  • Chain 'B':
    Compound: 3-oxoacyl-acyl carrier protein reductase
    Species: Lactobacillus brevis (strain ATCC 367 / JCM 1170) [TaxId:387344]
    Gene: LVIS_0330
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03TH6 (Start-280)
      • engineered mutation (185-186)
      • engineered mutation (229)
      • engineered mutation (232-233)
    Domains in SCOPe 2.07: d5zi0b_
  • Chain 'C':
    Compound: 3-oxoacyl-acyl carrier protein reductase
    Species: Lactobacillus brevis (strain ATCC 367 / JCM 1170) [TaxId:387344]
    Gene: LVIS_0330
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03TH6 (Start-280)
      • engineered mutation (185-186)
      • engineered mutation (229)
      • engineered mutation (232-233)
    Domains in SCOPe 2.07: d5zi0c_
  • Chain 'D':
    Compound: 3-oxoacyl-acyl carrier protein reductase
    Species: Lactobacillus brevis (strain ATCC 367 / JCM 1170) [TaxId:387344]
    Gene: LVIS_0330
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03TH6 (Start-280)
      • engineered mutation (185-186)
      • engineered mutation (229)
      • engineered mutation (232-233)
    Domains in SCOPe 2.07: d5zi0d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zi0A (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrmtdrlkdkvaiitggvagiglgiaecyv
    regakvvvtanhnvdggraavakfgddvslfvqqdvskeadwqkvidatiakfgrvdilv
    nnagiggvntaiedldladwqkvidvnltanflgekaaikamkqtadakgsiinvssvag
    lvglpidpaysaskggsrllthatalnlaqrgidirvnsvhpgwidtsiipedlrkqiia
    tipvghmgqpqdigevcvylgsdesrfangaeftvdggqra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zi0A (A:)
    tdrlkdkvaiitggvagiglgiaecyvregakvvvtanhnvdggraavakfgddvslfvq
    qdvskeadwqkvidatiakfgrvdilvnnagiggvntaiedldladwqkvidvnltanfl
    gekaaikamkqtadakgsiinvssvaglvglpidpaysaskggsrllthatalnlaqrgi
    dirvnsvhpgwidtsiipedlrkqiiatipvghmgqpqdigevcvylgsdesrfangaef
    tvdggqra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zi0B (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrmtdrlkdkvaiitggvagiglgiaecyv
    regakvvvtanhnvdggraavakfgddvslfvqqdvskeadwqkvidatiakfgrvdilv
    nnagiggvntaiedldladwqkvidvnltanflgekaaikamkqtadakgsiinvssvag
    lvglpidpaysaskggsrllthatalnlaqrgidirvnsvhpgwidtsiipedlrkqiia
    tipvghmgqpqdigevcvylgsdesrfangaeftvdggqra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zi0B (B:)
    tdrlkdkvaiitggvagiglgiaecyvregakvvvtanhnvdggraavakfgddvslfvq
    qdvskeadwqkvidatiakfgrvdilvnnagiggvntaiedldladwqkvidvnltanfl
    gekaaikamkqtadakgsiinvssvaglvglpidpaysaskggsrllthatalnlaqrgi
    dirvnsvhpgwidtsiipedlrkqiiatipvghmgqpqdigevcvylgsdesrfangaef
    tvdggqra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zi0C (C:)
    mgsshhhhhhssglvprgshmasmtggqqmgrmtdrlkdkvaiitggvagiglgiaecyv
    regakvvvtanhnvdggraavakfgddvslfvqqdvskeadwqkvidatiakfgrvdilv
    nnagiggvntaiedldladwqkvidvnltanflgekaaikamkqtadakgsiinvssvag
    lvglpidpaysaskggsrllthatalnlaqrgidirvnsvhpgwidtsiipedlrkqiia
    tipvghmgqpqdigevcvylgsdesrfangaeftvdggqra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zi0C (C:)
    tdrlkdkvaiitggvagiglgiaecyvregakvvvtanhnvdggraavakfgddvslfvq
    qdvskeadwqkvidatiakfgrvdilvnnagiggvntaiedldladwqkvidvnltanfl
    gekaaikamkqtadakgsiinvssvaglvglpidpaysaskggsrllthatalnlaqrgi
    dirvnsvhpgwidtsiipedlrkqiiatipvghmgqpqdigevcvylgsdesrfangaef
    tvdggqra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zi0D (D:)
    mgsshhhhhhssglvprgshmasmtggqqmgrmtdrlkdkvaiitggvagiglgiaecyv
    regakvvvtanhnvdggraavakfgddvslfvqqdvskeadwqkvidatiakfgrvdilv
    nnagiggvntaiedldladwqkvidvnltanflgekaaikamkqtadakgsiinvssvag
    lvglpidpaysaskggsrllthatalnlaqrgidirvnsvhpgwidtsiipedlrkqiia
    tipvghmgqpqdigevcvylgsdesrfangaeftvdggqra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zi0D (D:)
    tdrlkdkvaiitggvagiglgiaecyvregakvvvtanhnvdggraavakfgddvslfvq
    qdvskeadwqkvidatiakfgrvdilvnnagiggvntaiedldladwqkvidvnltanfl
    gekaaikamkqtadakgsiinvssvaglvglpidpaysaskggsrllthatalnlaqrgi
    dirvnsvhpgwidtsiipedlrkqiiatipvghmgqpqdigevcvylgsdesrfangaef
    tvdggqra