PDB entry 5zhq

View 5zhq on RCSB PDB site
Description: Crystal structure of Scylla paramamosain arginine kinase
Class: allergen
Keywords: Food allergy, sea food allergy, arginine kinase, ALLERGEN
Deposited on 2018-03-13, released 2019-03-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginine kinase
    Species: Scylla paramamosain [TaxId:85552]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zhqa1, d5zhqa2
  • Chain 'B':
    Compound: arginine kinase
    Species: Scylla paramamosain [TaxId:85552]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zhqb1, d5zhqb2
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zhqA (A:)
    madaatiakleegfkkleaatdcksllkkyltksvfdqlkgkktslgatlldviqsgven
    ldsgvgvyapdaeaytlfaplfdpiiedyhkgfkqtdkhpnkdfgdvnqfvnvdpdgkfv
    istrvrcgrsmegypfnpclteaqykemeskvsstlsnlegelkgtyypltgmtkdvqqk
    liddhflfkegdrflqaanacrywptgrgiyhndnktflvwcdeedhlriismqmggdlg
    qvyrrlvsavneiekrvpfshhdrlgfltfcptnlgttvrasvhiklpklaanrekleev
    agkyslqvrgtrgehteaeggvydisnkrrmgltefqavkemqdgilelikiekemq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zhqA (A:)
    adaatiakleegfkkleaatdcksllkkyltksvfdqlkgkktslgatlldviqsgvenl
    dsgvgvyapdaeaytlfaplfdpiiedyhkgfkqtdkhpnkdfgdvnqfvnvdpdgkfvi
    strvrcgrsmegypfnpclteaqykemeskvsstlsnlegelkgtyypltgmtkdvqqkl
    iddhflfkegdrflqaanacrywptgrgiyhndnktflvwcdeedhlriismqmggdlgq
    vyrrlvsavneiekrvpfshhdrlgfltfcptnlgttvrasvhiklpklaanrekleeva
    gkyslqvrgtrgehteaeggvydisnkrrmgltefqavkemqdgilelikiekem
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zhqB (B:)
    madaatiakleegfkkleaatdcksllkkyltksvfdqlkgkktslgatlldviqsgven
    ldsgvgvyapdaeaytlfaplfdpiiedyhkgfkqtdkhpnkdfgdvnqfvnvdpdgkfv
    istrvrcgrsmegypfnpclteaqykemeskvsstlsnlegelkgtyypltgmtkdvqqk
    liddhflfkegdrflqaanacrywptgrgiyhndnktflvwcdeedhlriismqmggdlg
    qvyrrlvsavneiekrvpfshhdrlgfltfcptnlgttvrasvhiklpklaanrekleev
    agkyslqvrgtrgehteaeggvydisnkrrmgltefqavkemqdgilelikiekemq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zhqB (B:)
    adaatiakleegfkkleaatdcksllkkyltksvfdqlkgkktslgatlldviqsgvenl
    dsgvgvyapdaeaytlfaplfdpiiedyhkgfkqtdkhpnkdfgdvnqfvnvdpdgkfvi
    strvrcgrsmegypfnpclteaqykemeskvsstlsnlegelkgtyypltgmtkdvqqkl
    iddhflfkegdrflqaanacrywptgrgiyhndnktflvwcdeedhlriismqmggdlgq
    vyrrlvsavneiekrvpfshhdrlgfltfcptnlgttvrasvhiklpklaanrekleeva
    gkyslqvrgtrgehteaeggvydisnkrrmgltefqavkemqdgilelikiekem