PDB entry 5zhm

View 5zhm on RCSB PDB site
Description: Crystal structure of TrmD from Pseudomonas aeruginosa in complex with active-site inhibitor
Class: transferase
Keywords: tRNA methyltransferase, TRANSFERASE
Deposited on 2018-03-13, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.76 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (guanine-N(1)-)-methyltransferase
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: trmD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02RL6 (23-268)
      • expression tag (21-22)
    Domains in SCOPe 2.07: d5zhma1, d5zhma2
  • Chain 'B':
    Compound: tRNA (guanine-N(1)-)-methyltransferase
    Species: Pseudomonas aeruginosa [TaxId:208963]
    Gene: trmD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02RL6 (23-268)
      • expression tag (20-22)
    Domains in SCOPe 2.07: d5zhmb1, d5zhmb2
  • Heterogens: 9D3, SAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zhmA (A:)
    mhhhhhhssgvdlgtenlyfqsmlwvgvvsifpemfraisdygitsravkqglltltcwn
    prvytedrhqtvddrpfgggpgmvmkikplegaladarqaaggrkakviylspqgrqltq
    agvrelaeeealiliagryegiderfieehvdeewsigdyvlsggelpamvlvdavtrll
    pgalghadsaeedsftdglldcphytrpevyadkrvpevllsgnhehirrwrlqqalgrt
    werradlldsrslsgeeqkllaeyirqrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zhmA (A:)
    smlwvgvvsifpemfraisdygitsravkqglltltcwnprvytedrhqtvddrpfgggp
    gmvmkikplegaladarqaaggrkakviylspqgrqltqagvrelaeeealiliagryeg
    iderfieehvdeewsigdyvlsggelpamvlvdavtrllpgalsftdglldcphytrpev
    yadkrvpevllsgnhehirrwrlqqalgrtwerradlldsrslsgeeqkllaeyirqrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zhmB (B:)
    mhhhhhhssgvdlgtenlyfqsmlwvgvvsifpemfraisdygitsravkqglltltcwn
    prvytedrhqtvddrpfgggpgmvmkikplegaladarqaaggrkakviylspqgrqltq
    agvrelaeeealiliagryegiderfieehvdeewsigdyvlsggelpamvlvdavtrll
    pgalghadsaeedsftdglldcphytrpevyadkrvpevllsgnhehirrwrlqqalgrt
    werradlldsrslsgeeqkllaeyirqrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zhmB (B:)
    qsmlwvgvvsifpemfraisdygitsravkqglltltcwnprvytedrhqtvddrpfggg
    pgmvmkikplegaladarqaaggrkakviylspqgrqltqagvrelaeeealiliagrye
    giderfieehvdeewsigdyvlsggelpamvlvdavtrllpgaldglldcphytrpevya
    dkrvpevllsgnhehirrwrlqqalgrtwerradlldsrslsgeeqkllaeyirqrd