PDB entry 5zhk

View 5zhk on RCSB PDB site
Description: Crystal structure of TrmD from Mycobacterium tuberculosis in complex with active-site inhibitor
Class: transferase
Keywords: tRNA methyltransferase, TRANSFERASE
Deposited on 2018-03-13, released 2019-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-06, with a file datestamp of 2019-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (guanine-N(1)-)-methyltransferase
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Gene: trmD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zhka_
  • Heterogens: 9D6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zhkA (A:)
    mridivtifpacldplrqslpgkaiesglvdlnvhdlrrwthdvhhsvddapygggpgmv
    mkapvwgealdeicssetllivptpagvlftqataqrwtteshlvfacgryegidqrvvq
    daarrmrveevsigdyvlpggesaavvmveavlrllagvlgnpashqddshstgldglle
    gpsytrpaswrgldvpevllsgdhariaawrrevslqrtrerrpdlshpdgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zhkA (A:)
    mridivtifpacldplrqslpgkaiesglvdlnvhdlrrwthdvhhsvddapygggpgmv
    mkapvwgealdeicssetllivptpagvlftqataqrwtteshlvfacgryegidqrvvq
    daarrmrveevsigdyvlpggesaavvmveavlrllagllegpsytrpaswrgldvpevl
    lsgdhariaawrrevslqrtrerrpdls