PDB entry 5zhi

View 5zhi on RCSB PDB site
Description: Apo crystal structure of TrmD from Mycobacterium tuberculosis
Class: transferase
Keywords: tRNA methyltransferase, TRANSFERASE
Deposited on 2018-03-13, released 2019-03-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA (guanine-N(1)-)-methyltransferase
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: trmD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zhia_
  • Chain 'B':
    Compound: tRNA (guanine-N(1)-)-methyltransferase
    Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) [TaxId:83331]
    Gene: trmD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5zhib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zhiA (A:)
    mridivtifpacldplrqslpgkaiesglvdlnvhdlrrwthdvhhsvddapygggpgmv
    mkapvwgealdeicssetllivptpagvlftqataqrwtteshlvfacgryegidqrvvq
    daarrmrveevsigdyvlpggesaavvmveavlrllagvlgnpashqddshstgldglle
    gpsytrpaswrgldvpevllsgdhariaawrrevslqrtrerrpdlshpdgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zhiA (A:)
    mridivtifpacldplrqslpgkaiesglvdlnvhdlrrwthdvhhsvddapygggpgmv
    mkapvwgealdeicssetllivptpagvlftqataqrwtteshlvfacgryegidqrvvq
    daarrmrveevsigdyvlpggesaavvmveavlrllaggllegpsytrpaswrgldvpev
    llsgdhariaawrrevslqrtrerrpdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zhiB (B:)
    mridivtifpacldplrqslpgkaiesglvdlnvhdlrrwthdvhhsvddapygggpgmv
    mkapvwgealdeicssetllivptpagvlftqataqrwtteshlvfacgryegidqrvvq
    daarrmrveevsigdyvlpggesaavvmveavlrllagvlgnpashqddshstgldglle
    gpsytrpaswrgldvpevllsgdhariaawrrevslqrtrerrpdlshpdgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zhiB (B:)
    mridivtifpacldplrqslpgkaiesglvdlnvhdlrrwthdvhhsvddapygggpgmv
    mkapvwgealdeicssetllivptpagvlftqataqrwtteshlvfacgryegidqrvvq
    daarrmrveevsigdyvlpggesaavvmveavlrllagvlgngllegpsytrpaswrgld
    vpevllsgdhariaawrrevslqrtrerrpdl