PDB entry 5zhh

View 5zhh on RCSB PDB site
Description: Structure of Inositol monophosphatase from Anabaena (Nostoc) sp. PCC 7120
Class: hydrolase
Keywords: Inositol monophosphatase, HYDROLASE
Deposited on 2018-03-13, released 2019-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inositol-1-monophosphatase
    Species: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) [TaxId:103690]
    Gene: all2917
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zhha_
  • Chain 'B':
    Compound: Inositol-1-monophosphatase
    Species: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) [TaxId:103690]
    Gene: all2917
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zhhb_
  • Chain 'C':
    Compound: Inositol-1-monophosphatase
    Species: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) [TaxId:103690]
    Gene: all2917
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zhhc_
  • Chain 'D':
    Compound: Inositol-1-monophosphatase
    Species: Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) [TaxId:103690]
    Gene: all2917
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zhhd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zhhA (A:)
    mtnlqtfldiateaalaagavlqgylgkledaitekgrpgdlvtaadkaseavvleiirr
    hfpqhsilaeesgklgnqdneylwaidpldgttnyahqypafcvsigllingvpqvgviy
    dpfhdelfrgaaglgatrnrrpikvsdtselsksllvtgfaydrretpdnnyaefchlth
    ltqgvrrsgsaaldlahvacgrvdgywergispwdvvagvilleeaggkvtaydstplki
    atgrilatngsihdnlsralmqvpplsawe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zhhA (A:)
    tnlqtfldiateaalaagavlqgylvtaadkaseavvleiirrhfpqhsilaeesgklgn
    qdneylwaidpldgttnyahqypafcvsigllingvpqvgviydpfhdelfrgaaglgat
    rnrrpikvsdtselsksllvtgfaydrretpdnnyaefchlthltqgvrrsgsaaldlah
    vacgrvdgywergispwdvvagvilleeaggkvtaydstplkiatgrilatngsihdnls
    ralmqvpplsaw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zhhB (B:)
    mtnlqtfldiateaalaagavlqgylgkledaitekgrpgdlvtaadkaseavvleiirr
    hfpqhsilaeesgklgnqdneylwaidpldgttnyahqypafcvsigllingvpqvgviy
    dpfhdelfrgaaglgatrnrrpikvsdtselsksllvtgfaydrretpdnnyaefchlth
    ltqgvrrsgsaaldlahvacgrvdgywergispwdvvagvilleeaggkvtaydstplki
    atgrilatngsihdnlsralmqvpplsawe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zhhB (B:)
    tnlqtfldiateaalaagavlqgylvtaadkaseavvleiirrhfpqhsilaneylwaid
    pldgttnyahqypafcvsigllingvpqvgviydpfhdelfrgaaglgatrnrrpikvsd
    tselsksllvtgfaydrretpdnnyaefchlthltqgvrrsgsaaldlahvacgrvdgyw
    ergispwdvvagvilleeaggkvtaydstplkiatgrilatngsihdnlsralmqvppls
    aw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5zhhC (C:)
    mtnlqtfldiateaalaagavlqgylgkledaitekgrpgdlvtaadkaseavvleiirr
    hfpqhsilaeesgklgnqdneylwaidpldgttnyahqypafcvsigllingvpqvgviy
    dpfhdelfrgaaglgatrnrrpikvsdtselsksllvtgfaydrretpdnnyaefchlth
    ltqgvrrsgsaaldlahvacgrvdgywergispwdvvagvilleeaggkvtaydstplki
    atgrilatngsihdnlsralmqvpplsawe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zhhC (C:)
    mtnlqtfldiateaalaagavlqgylgvtaadkaseavvleiirrhfpqhsilaedneyl
    waidpldgttnyahqypafcvsigllingvpqvgviydpfhdelfrgaaglgatrnrrpi
    kvsdtselsksllvtgfaydrretpdnnyaefchlthltqgvrrsgsaaldlahvacgrv
    dgywergispwdvvagvilleeaggkvtaydstplkiatgrilatngsihdnlsralmqv
    pplsaw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5zhhD (D:)
    mtnlqtfldiateaalaagavlqgylgkledaitekgrpgdlvtaadkaseavvleiirr
    hfpqhsilaeesgklgnqdneylwaidpldgttnyahqypafcvsigllingvpqvgviy
    dpfhdelfrgaaglgatrnrrpikvsdtselsksllvtgfaydrretpdnnyaefchlth
    ltqgvrrsgsaaldlahvacgrvdgywergispwdvvagvilleeaggkvtaydstplki
    atgrilatngsihdnlsralmqvpplsawe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zhhD (D:)
    mtnlqtfldiateaalaagavlqgylgvtaadkaseavvleiirrhfpqhsilaneylwa
    idpldgttnyahqypafcvsigllingvpqvgviydpfhdelfrgaaglgatrnrrpikv
    sdtselsksllvtgfaydrretpdnnyaefchlthltqgvrrsgsaaldlahvacgrvdg
    ywergispwdvvagvilleeaggkvtaydstplkiatgrilatngsihdnlsralmqvpp
    lsawe