PDB entry 5zhe

View 5zhe on RCSB PDB site
Description: structure of e. coli undecaprenyl diphosphate synthase in complex with bph-981
Class: transferase/inhibitor
Keywords: metal-binding, substrate binding, acidocalcisomal pyrophosphatase, TRANSFERASE-INHIBITOR complex
Deposited on 2018-03-13, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ispU, rth, uppS, yaeS, b0174, JW0169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zhea_
  • Chain 'B':
    Compound: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ispU, rth, uppS, yaeS, b0174, JW0169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zheb_
  • Heterogens: HJX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zheA (A:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zheA (A:)
    pahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafsal
    dsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggrwdivq
    gvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqiayae
    lyftdvlwpdfdeqdfegalnafanr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zheB (B:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zheB (B:)
    gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafswalds
    evkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggrwdivqgv
    rqlaekvqqqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqiayaelyftd
    vlwpdfdeqdfegalnafan