PDB entry 5zhb

View 5zhb on RCSB PDB site
Description: Structure of Cellobiose 2-Epimerase from Bacillus thermoamylovorans B4167
Class: isomerase
Keywords: cellobiose 2-epimerase, epimerization, BIOSYNTHETIC PROTEIN, ISOMERASE
Deposited on 2018-03-12, released 2019-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellobiose 2-epimerase
    Species: Bacillus thermoamylovorans [TaxId:35841]
    Gene: B4166_1736, B4167_1620
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zhba_
  • Chain 'B':
    Compound: Cellobiose 2-epimerase
    Species: Bacillus thermoamylovorans [TaxId:35841]
    Gene: B4166_1736, B4167_1620
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5zhbb_
  • Heterogens: EDO

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5zhbA (A:)
    mntfvnefrnelethilpfwaklkddenggyyglvdydlhvhkdagkggiatcrqlwafs
    aayrvlkkeaylqqanhayrflteyvfdhqykglywmvdykgnpsddrkhvyaqafgvya
    lteyyrvtqnqealdyakqlyklietvgfneetnaykeefnrkweeqsnemlsengviad
    itmnthlhvleaytnlyrvwedeqlkgrianlidlfyekvfdkqskflqvffnnhwesii
    dlksyghdieaswliddalkvtgnndrkytqmvidiayniekkgvlkdgslayenengki
    dytrvwwvqveamvgfynayektkdekflkaveriwdyvktymidsreggewywsveadg
    qptkreiagpwkcpyhnarfclefiervgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zhbA (A:)
    mntfvnefrnelethilpfwaklkddenggyyglvdydlhvhkdagkggiatcrqlwafs
    aayrvlkkeaylqqanhayrflteyvfdhqykglywmvdykgnpsddrkhvyaqafgvya
    lteyyrvtqnqealdyakqlyklietvgfneetnaykeefnrkweeqsiaditmnthlhv
    leaytnlyrvwedeqlkgrianlidlfyekvfdkqskflqvffnnhwesiidlksyghdi
    easwliddalkvtgnndrkytqmvidiayniekkgvlkdgslayenengkidytrvwwvq
    veamvgfynayektkdekflkaveriwdyvktymidsreggewywsveadgqptkreiag
    pwkcpyhnarfclefiervg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zhbB (B:)
    mntfvnefrnelethilpfwaklkddenggyyglvdydlhvhkdagkggiatcrqlwafs
    aayrvlkkeaylqqanhayrflteyvfdhqykglywmvdykgnpsddrkhvyaqafgvya
    lteyyrvtqnqealdyakqlyklietvgfneetnaykeefnrkweeqsnemlsengviad
    itmnthlhvleaytnlyrvwedeqlkgrianlidlfyekvfdkqskflqvffnnhwesii
    dlksyghdieaswliddalkvtgnndrkytqmvidiayniekkgvlkdgslayenengki
    dytrvwwvqveamvgfynayektkdekflkaveriwdyvktymidsreggewywsveadg
    qptkreiagpwkcpyhnarfclefiervgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zhbB (B:)
    mntfvnefrnelethilpfwaklkddenggyyglvdydlhvhkdagkggiatcrqlwafs
    aayrvlkkeaylqqanhayrflteyvfdhqykglywmvdykgnpsddrkhvyaqafgvya
    lteyyrvtqnqealdyakqlyklietvgfneetnaykeefnrkweeqiaditmnthlhvl
    eaytnlyrvwedeqlkgrianlidlfyekvfdkqskflqvffnnhwesiidlksyghdie
    aswliddalkvtgnndrkytqmvidiayniekkgvlkdgslayenengkidytrvwwvqv
    eamvgfynayektkdekflkaveriwdyvktymidsreggewywsveadgqptkreiagp
    wkcpyhnarfclefiervg