PDB entry 5zh6

View 5zh6 on RCSB PDB site
Description: Crystal structure of Parvalbumin SPV-II of Mustelus griseus
Class: allergen
Keywords: Allergen, food allergen, sea food allergy, Parvalbumin
Deposited on 2018-03-11, released 2018-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-01, with a file datestamp of 2018-07-27.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Parvalbumin SPV-II
    Species: Mustelus griseus [TaxId:89020]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZH6 (0-106)
    Domains in SCOPe 2.07: d5zh6a_
  • Chain 'B':
    Compound: Parvalbumin SPV-II
    Species: Mustelus griseus [TaxId:89020]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ZH6 (0-End)
    Domains in SCOPe 2.07: d5zh6b_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5zh6A (A:)
    gsittvlnatdiakalaqcagsfnhktffvtsgltnksdanlakvfdildqdrsgfievd
    elklflqnfsatareldetetnaflaagdsdhdgkigvdefkamvka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5zh6B (B:)
    gsittvlnatdiakalaqcagsfnhktffvtsgltnksdanlakvfdildqdrsgfievd
    elklflqnfsatareldetetnaflaagdsdhdgkigvdefkamvka
    

    Sequence, based on observed residues (ATOM records): (download)
    >5zh6B (B:)
    gsittvlnatdiakalaqcagsfnhktffvtsgltnksdanlakvfdildqdrsgfievd
    elklflqnfsatareldetetnaflaagdsdhdgkigvdefkamvk